Curs valutar


1 EURO = 4.7536 RON  
1 USD = 4.3072 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Transmitatoare/Receptoare optice de semnal Audio-Video

Receptor optic semnal A-V stereo, fibra SM Fibridge F7-1VR-1AT-1DT-S042S

Receptor optic semnal A-V stereo, fibra SM

Fibridge - F7-1VR-1AT-1DT-S042S

Receptor optic 1 canal VIDEO + 1 canal STEREO AUDIO, o fibra SM, 40km

Pret fara TVA:
1,045.79 RON

Pret cu TVA :
1.244,49 RON

Disponibilitate :

1 Channel Digital Video Optical Transmitter & Receiver
with 1 Stereo Audio and 1 Data Optional
   The Product provides customer with the most cost-effective solution for transmission of 1 channel uncompressed digital video, 1 reversed stereo audio and 1 reversed RS232/RS422/RS485 data over one single fiber cable. It is an easy installation and adjustment free device while providing high quality, real-time video. The product may also be maintained by our future product, FB-V1000NMS, a Network Management System. Applications for this product include CCTV, video surveillance, homeland security, ITS and etc.
 • Transports 1 channel digitized, high quality, uncompressed video
 • 8MHz video bandwidth, Compatible with NTSC, PAL and SECAM
 • Provides 1 reversed stereo audio and 1 reversed data transmission over same optical fiber
 • Easy installation and adjustment free
 • Transmission range up to 120KM depending on model
 • RS232, RS422/RS485 compatible data interfaces
 • Stand alone operation or mount in chassis
 • 220VAC/50Hz, standalone device
 • 0.2A@12VDC for rack card
 • Power, Link Status, Video Signal
 • Audio status, Data traffic
 • Video Signal: 1Vp-p, 75ohm
 • Digitization: 8bits/10bits
 • Bandwidth: 8MHz
 • DG <1%
 • DP <1 degree
 • SNR >60dB(weighted)
 • Connectors: 1 BNCs
Physical Dimensions:
 • 176X220X25.4(mm) Card
 • 130 x 122 x 36(mm) Standalone
 • Channel: 1 stereo audio
 • Audio Input: unbalanced, 600Ohms
 • Digitization: 16bit@48k
 • Frequency: 10Hz to 20KHz
 • SNR: >70dB
 • Connector: RJ45 or RCA
 • Channel: 1, Reversed
 • Data Rate: 0~~23.04Kbps/channel
 • Selectable RS-232/RS-422/RS-485
 • Connector: RJ45 or Terminal Block with Screw Clamps
 • Operating: -40°C~+70°C
 • Storage: -40°C~+85°C
 • Humidity: 0-95% Non-Condensing
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept