Curs valutar


1 EURO = 4.7315 RON  
1 USD = 4.2103 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km


 » Echipamente pentru receptia si transmisia digitala a canalelor de televiziune pe cablu

Receptor/Decodor digital profesional

Receptor digital profesional

Wellav - UMH-160 HD IP

Receptor digital profesional (IRD) .HD, intrare optionala DVB S2/T/C , pt rack 19", multi-decript, prevazut cu doua sloturi CI iesire ASI/SDI,  Intrare/Iesire IP

Cere oferta
Disponibilitate :
La comanda

UMH160 Receiver/Decoder

UMH 160 is Wellav's standard DVB MPEG-2/H.264 receiver decoder. It can receives MPEG-2 and H.264 signals in DVB-S/S2, DVB-C/T, ASI and TS/IP format and convert signals to CVBS,HDMI, HD/SD-SDI, ASI and TS/IP. It also supports multi-channel DVB decryption and BISS descrambling. With web-based network management interface, it is an ideal equipment for large scale content contribution and distribution.


  • Receive MPEG-2/H.264 signals in DVB-C/T/S/S2, ASI and TS/IP (optional) format
  • Decrypt multi-channel programs via two common interface slots, which support descrambling of CAS such as Conax, Irdeto, Viacess, NDS, Verimatrix/Comvenient, CTI and etc.
  • Support ASI-IP & IP-ASI real time conversion and transmission for signal transmission (UMH160 IP)
  • Support program edition and AD insertion via SD/HD-SDI output
  • Support program filtering and timer function
  • Support BISS-1 and BISS-E function
  • Support online and remote configuration via network management software and SNMP integration


DVB-S/S2 Input

  • Constellation: QPSK, 8PSK
  • Symbol Rate: 1~45Mbps (QPSK)
  • FEC: All rations compiant with standard
  • Frequency: 950~2150Mhz
  • Signal Level: -65~-25dbm

DVB-T Input

  • Constellation: COFDM, 2K&8K FFT
  • Symbol Rate: 0.45~7Mbps (QPSK)
  • Frequency: 174~230Mhz, 474~858Mhz
  • Signal Level: -80~-20dBm

DVB-C Input

  • Constellation: QAM (16/32/64/128/256)
  • Symbol Rate: 3~6.9Msps
  • Frequency: 48~862Mhz
  • Signal Level: 32~100dBuV

ISDB-T Input

  • Constellation: OFDM (64QAM/16QAM/QPSK/DQPSK), 2K, 4K & 8K FFT 
  • Frequency: 470~806MHz
  • Bandwidth: 6 MHz
  • Input impedance: 75 Ω
  • Input level: -90~-5dBm


  • Connector: BNC, 75Ω
  • Packet Length: 188 & 204 byte packets
  • TS Max Bit Rate: 72Mbps

TS/IP Inputs (Optional)

  • Connector: 100/1000Base-T, RJ-45
  • FEC: Pro-MPEG
  • Encapsulation Protocol: UDP, RTP
  • Broadcasting type: Unicast and Multicast

Video/Audio Outputs

  • 2XCVBS outputs (1 BNC, 1 RCA)
  • 1X Component output (YPbPr)
  • 1X HDMI output (with HDCP 720p & 1080i)
  • 1XAES/EBU digital audio output
  • 2XHD/SD-SDI outputs (with embedded digital audio)

DVB-ASI Outputs

  • Connector: BNC, 75Ω
  • Packet Length: 188 & 204 byte packets
  • TS Max Bit Rate: 72Mbps

TS/IP Outputs (Optional)

  • Connector: 100/1000Base-T, RJ-45
  • FEC: Pro-MPEG
  • Up to 8 streams Multicast or Unicast
  • Broadcast type: Unicast and Multicast
  • Supporting Protocol: DHCP, TCP/IP, ARP, IGMP (V2/V3)

Video Decoding

  • Decoding Formats: MPEG-2/H.264 SD & HD
  • Decoding Resolution: 480i, 576i, 720p, 1080i
  • Format: PAL/NTSC/SECAM

Audio Decoding

  • Standard: MPEG-1 Layer II, Mpeg-2, AAC, AC-3
  • Sampling Frequency: 48KHz, 44.1KHz, 32KHz

Conditional Access

  • Interface: Two independent CI Slots
  • CAM Methods: Multicrypt, Simulcrypt
  • CAS: Conax, Irdeto, Viaccess, Nagravision, CTI, DV-crypt, etc.


  • Front panel keyboard and LCD display
  • Network Management Software (SNMP support)
  • Web Management

Physical & Environment

  • Power: AC90~250V, 50/60Hz, 30W (max)
  • Size: 1RU rack  mount chassis
  • Dimension(HxWxD): 44mmx484mmx274mm
  • Net Weight: 3.8Kg
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept