Curs valutar


1 EURO = 4.7315 RON  
1 USD = 4.2103 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km


 » Echipamente pentru receptia si transmisia digitala a canalelor de televiziune pe cablu

Receptor digital TV Cablu WHD-7000N

Receptor digital TV Cablu

Wellav - WHD-7000N

SET-TOP-BOX HD MPEG-4 pt abonati (DVB-C HD), suporta CAS Irdeto/Conax/WF, iesiri scart, AV, S/PDIF, teletext, afisaj OSD multi lingv.

Cere oferta
Disponibilitate :

H.264/MPEG-4 IP Receiver WHD700N

WHD700N is a H.264/MPEG-4 compliant SD/HD IP set top box (receiver) that helps operators deliver the best in entertainment experience to their subscribers with its max 1080i definition video and stereo sound. With IGMP V2/V3 Ethernet communication, it allows users video on demand to match IPTV applications.


  • DVB-C/T/S/S2 support (optional)
    MPEG-4 AVC/H.264 HP @ L4, MPEG-2 MP@ML, MPEG2 MP@HL
  • IPTV and video-on-Demand support
  • High Definition Video in 1080i via HDMI or YPrPb
  • Two common interfaces, compliant with DVB/NRSS-B/DAVIC V1.2(optional)
  • CAS support
  • VBI teletext support
  • Multi language EPG, teletext and DVB subtitle support
  • Record and pre-record function
  • Transparent Picture-in-Picture function
  • Advertising via reboot screen, menu and programs
  • Up to 5000 TV and radio channels programmable
  • Four search modes: Manual/NIT/All frequency/Advanced
  • 8 favourite channel groups setting, 10 timer setting and parental lock function
  • DiSEqC1.0 and DiSEqC1.2 function for DVB-S-S2 receiver
  • USB upgrading and OTA support
  • Support CAS including: Conax, Wellfly, Keyfly, Comvenient/BetaCrypt, CTI, DVCrypt, Panaccess, Novel SuperTV, Safeview and more


Inputs and signal processing(DVB-C)

  • Input signal level: -32~105dBuV
  • Input symbol rate: 0.45~7.0Mb/s
  • Input frequency: 50~858MHz
  • Input impedance: 75ohm
  • Connector: IEC F-type
  • Demodulator: 16/32/64/128/256QAM

Common Interface & USB

  • 2 CI compliant with DVB (CENELECEN-50221)
  • USB input

IP Input & Output

  • Connector 100/1000Base-T, RJ-45
  • Error correction: Pro-MPEG FEC

Video processing/Audio processing

  • Video decoding : MPEG-4 AVC/H.264
    HP@L4, MPEG-2 MP@HL/ML
  • Aspect ratio: 4:3, 16:9
  • Video Output: 1080p/1080i/720p
  • Audio decoding: MPEG-4 AAC, MPEG-2 AAC and AAC+, MPEG layer I&II
  • Sound model: Stereo/Joint Stereo
  • A/V output: RCA, SCART, S/PDIF(optional), YPrPb, HDMI

System resources

  • Main Processor: ST7162
  • Flash memory: 64MByte~1GByte
  • Main processor speed: 450MHz
  • SDRAM: 256MByte

Physical characteristics


  • Input voltage: AC90~250V 50/60Hz
  • Power consumption: 20W (max)


  • Operating temperature: 5°C~45°C


  • (HxWxD): 42mm x 305mm x 243mm
  • Net weight: 1.3Kg
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept