Curs valutar


1 EURO = 4.8387 RON  
1 USD = 4.3203 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


 » Echipamente pentru receptia si transmisia digitala a canalelor de televiziune pe cablu

Receptor digital TV Cablu MPEG-2

Receptor digital TV Cablu

Wellav - WCD-1202

SET-TOP-BOX digital MPEG-2 pt abonati (DVB-C), suporta CAS Irdeto/Conax/WF, iesiri scart, AV, S/PDIF, teletext, afisaj OSD multi lingv.

Alte imagini:
Receptor digital TV Cablu MPEG-2
Cere oferta
Disponibilitate :

DVB-C Receiver WCD-1202

WCD1202 a second generation cost effective DVB cable receiver that helps cable operators bring content to live subscribers. With improved stability and multiple new features, WCD1205 provides more options for operators to customize for their unique environments.


  • Fully MPEG-2 digital and DVB-C compliant
  • CAS support
  • ITU J.83 Annex A support
  • Support advertising via opening page, menu and programs
  • Super fast teletext (OSD and VBI)
  • Multi language EPG, teletext and DVB subtitle support
  • True color on-screen display with multiple languages
  • Up to 5000 TV and radio channels programmable
  • Variable Aspect Ratio (4:3, 16:9) with Pan Vector and Letter Box
  • Four search modes: Manual/NIT/All frequency/Advanced
  • 8 favourite channel groups setting, 10 timer setting and parental lock function
  • Electronic Games embeded
  • Software upgrades through RS232 port and over the cable
  • Support CAS including: Conax, Wellfly, Keyfly, Comvenient/BetaCrypt, DVCrypt, CTI and more


Inputs and signal processing

  • Input signal level: -32~105dBuV
  • Input symbol rate: 0.45~7.0Mb/s
  • Input frequency: 50~858MHz
  • Input impedance: 75ohm
  • Connector: IEC F-type
  • Demodulator: 16/32/64/128/256QAM
  • 1 RS232 input for software upgrade

Common Interface & USB

  • 2 CI compliant with DVB (CENELECEN-50221)
  • USB input

IP Input & Output

  • Connector 100/1000Base-T, RJ-45
  • Error correction: Pro-MPEG FEC

Video processing/Audio processing

  • Video decoding : MPEG-2 MP@ML
  • Aspect ratio: 4:3, 16:9, Pan&Scan, Letter Box, Combine, Ignore
  • Audio decoding: MPEG layer I&II
  • Sound model: Stereo/Joint Stereo
  • A/V output: RCA, SCART, S/PDIF(coaxial), component, RF (optional)

System resources

  • Main Processor: ST5105
  • Flash memory: 2MByte or 4MByte
  • Main processor speed: 200MHz
  • SDRAM: 32MByte

Physical characteristics


  • Input voltage: AC90~250V 50/60Hz
  • Power consumption: 10W (max)


  • Operating temperature: 0°C~45°C


  • (HxWxD): 42mm x 250mm x 170mm
  • Net weight: 1.3Kg
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept