Curs valutar

10-Jul-2020

1 EURO = 4.8408 RON  
1 USD = 4.2716 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszh

ANPC

 » Receptoare de satelit digitale High Definition



Optibox Ultra

Receptor de satelit digital high definition cu cititor Conax

Optibox - Optibox Ultra

Recetor de satelit digital high definition PVR Ready, H.264/MPEG-4 - HD / DVB-S2 Tuner, 1 slot SmartCard Conax, USB 2.0, iesire video si audio (576i,576p,720p,1080i)

Optibox Ultra este o versiune ușoara a receptorului Optibox CX PVR EXTRA. Are o ieșire HDMI. Receptorul are dimensiuni mici, panoul frontal dispune de o interfața USB pentru a înregistra programul vizualizat pe un HDD extern sau un FlashDisk. 

Alte imagini:
Optibox UltraOptibox UltraOptibox UltraOptibox Ultra
 
Optibox Ultra

Pret fara TVA:
123.06 RON

Pret cu TVA :
146,45 RON

Disponibilitate :
Sunati

Optibox Ultra PVR HDMI

cod: 0004316

Cititor de carduri: DA (1x)

CI slot: NU

afișare: NU

Numar de tunere (tip): 1x (DVB-S)

Pregatirea HDD: NU

HDD încorporat: NU

Conector USB: DA (1x)

Suport pentru subtitrare: DA

Teletext: DA

Numar de preferințe: 10.000 TV & R

Canale preferate: DA

timer: DA

Blocare parentala: DA

Suport MP3: DA

Joc: DA

Suport DiSEqC: DA

Suport TimeShift: DA (cu LAN conectat)

Înregistrarea pe o unitate USB externa: DA (cu LAN conectat)

Rezoluția video: 720x576 (PAL) / (NTSC)

Formatul imaginii: 4: 3, 16: 9 (Letter Box)

Conector SCART: DA (1x)

Conector HDMI: DA

Ieșire RCA compusa: NU

Componenta ieșire YPbPr: NU

Conector S-VHS: NU

Conector RS-232: DA

LAN (RJ45): NU

Ieșire audio coaxiala: NU

Ieșire audio optica: NU

Modulatorul UHF: NU

Comutator de alimentare: NU

Actualizare software: DA (prin USB)

Culoare: negru

Dimensiuni: 220 x 145 x 35 mm

Greutate: 0,7 kg

Descriere produs:
Optibox Ultra este o versiune ușoara a receptorului Optibox CX PVR EXTRA. Are o ieșire HDMI. Receptorul are dimensiuni mici, panoul frontal dispune de o interfața USB pentru a înregistra programul vizualizat pe un HDD extern sau un FlashDisk. 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept