Curs valutar

18-Jun-2019

1 EURO = 4.7228 RON  
1 USD = 4.1899 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200

ANPC

 » Receptoare de satelit digitale High Definition



Optibox Ultra

Receptor de satelit digital high definition cu cititor Conax

Optibox - Optibox Ultra

Recetor de satelit digital high definition PVR Ready, H.264/MPEG-4 - HD / DVB-S2 Tuner, 1 slot SmartCard Conax, USB 2.0, iesire video si audio (576i,576p,720p,1080i)

Optibox Ultra este o versiune ușoară a receptorului Optibox CX PVR EXTRA. Are o ieșire HDMI. Receptorul are dimensiuni mici, panoul frontal dispune de o interfață USB pentru a înregistra programul vizualizat pe un HDD extern sau un FlashDisk. 

Alte imagini:
Optibox UltraOptibox UltraOptibox UltraOptibox Ultra
 
Optibox Ultra

Pret: 116.00 RON
*) Pretul nu contine TVA
Disponibilitate :
In stoc

Optibox Ultra PVR HDMI

cod: 0004316

Cititor de carduri: DA (1x)

CI slot: NU

afișare: NU

Număr de tunere (tip): 1x (DVB-S)

Pregătirea HDD: NU

HDD încorporat: NU

Conector USB: DA (1x)

Suport pentru subtitrare: DA

Teletext: DA

Număr de preferințe: 10.000 TV & R

Canale preferate: DA

timer: DA

Blocare parentală: DA

Suport MP3: DA

joc: DA

Suport DiSEqC: DA

Suport TimeShift: DA (cu LAN conectat)

Înregistrarea pe o unitate USB externă: DA (cu LAN conectat)

Rezoluția video: 720x576 (PAL) / (NTSC)

Formatul imaginii: 4: 3, 16: 9 (Letter Box)

Conector SCART: DA (1x)

Conector HDMI: DA

Ieșire RCA compusă: NU

Componentă ieșire YPbPr: NU

Conector S-VHS: NU

Conector RS-232: DA

LAN (RJ45): NU

Ieșire audio coaxială: NU

Ieșire audio optică: NU

Modulatorul UHF: NU

Comutator de alimentare: NU

Actualizare software: DA (prin USB)

Culoare: negru

dimensiuni: 220 x 145 x 35 mm

greutate: 0,7 kg

Descriere produs:
Optibox Ultra este o versiune ușoară a receptorului Optibox CX PVR EXTRA. Are o ieșire HDMI. Receptorul are dimensiuni mici, panoul frontal dispune de o interfață USB pentru a înregistra programul vizualizat pe un HDD extern sau un FlashDisk. 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept