Curs valutar


1 EURO = 4.8278 RON  
1 USD = 4.4355 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9


 » Receptoare de satelit digitale High Definition

Receptor de satelit digital Optibox KOALA

Receptor de satelit digital high definition

Optibox - KOALA

Recetor de satelit digital high definition PVR Ready, H.264/MPEG-4 - HD / DVB-S2 Tuner, 2 sloturi CI, 1 slot SmartCard, Linux OS, interfata RJ-45, USB 2.0, iesire video si audio (576i,576p,720p,1080i), PiP, SPDIF


Alte imagini:
Receptor de satelit digital Optibox KOALAReceptor de satelit digital Optibox KOALA

Pret nou fara TVA :
307,66 RON

Pret nou cu TVA :
366,12 RON

Disponibilitate :

Optibox KOALA
General Data:
- Digital Satellite receiver & PVR Ready
- H.264 / MPEG4 - HD,SD / DVB-S2 Tuner
- 1 Smart card reader and 2 Common Interface Slots
Powerful compatibility through Embedded Linux OS
- Recording & Playback with External USB 2.0 Devices
- Recording and Time Shifting Simultaneously
- Recording and Playback Simultaneously
- Powerful Extended EPG supports and Event Recording
- USB 2.0 Host Support (MP3 Player & JPEG Viewer)
Xvid file play back supported
Ethernet port Supported
- Intelligent Blind Scan for both SD and HD TV & Multi-Satellite Search
- White VFD Display (8 Digit Alphanumeric)
- HDMI Video & Audio Output (576i, 576p, 720p, 1080i)
- PIP(Picture-in-Picture) & Multi-picture(*)
- Multi-LNB Controlled by DiSEqC Control Version 1.0, 1.1, 1.2 and USALS
- On-Screen Display with Full Color & Resolution
- Favorite Service Groups
- Powerful Service Control by Favorites, Lock, Skip, Move and Delete
- Service Sorting by Alphabet, Transponder and CAS
- User Friendly & Multi-language Supported (OSD & Menu)
- Teletext Support
- Maximum 10,000 Services Programmable
- Parental Lock / System Lock / Installation Lock
- HDMI Video & Audio Output (576i, 576p, 720p, 1080i)
- Supports Y/Pb/Pr(component) Output in HD
- CVBS(composite) Video & Audio Output via RCA
- Optical Output for Digital Audio(SPDIF)
- Software & Service channel Database upgrade via USB & RS-232C port
- 1W Stand-by Power Consumption
Tuner & Channel Decoder
Input Connector: F-type, IEC 169-24, Female
Loop through out: F-type, IEC 169-24, Female
Frequency Range: 950MHz ~ 2150MHz
Input Impedance: 75Ohm, unbalanced
Signal Level: -65 to -25dBm
LNB Power: 13/18VDC, max.400mA
22KHz Tone: (22±2)KHz, (0.6±0.2)V
DiSEqC Control: V1.0/1.2/USALS Compatible
Demodulation: QPSK / 8PSK
Input Symbol Rate: 1 ~ 45 Ms/s(QPSK of DVB-S)
1 ~ 45 Ms/s(QPSK of DVB-S2)
FEC Decoder: 1/2, 2/3, 3/4, 5/6 and 7/8 with Constraint Length K=7(DVB-S)
1/2, 3/5, 2/3, 3/4, 4/5, 5/6, 8/9 and 9/10 (DVB-S2)

MPEG Transport Stream A/V Decoding
Transport Stream: H.264(MPEG-4 part 10, MPEG-4/AVC and H26L)
Profile Level: MPEG-II ISO/IEC 13818-2/11172-2
Input Rate: Max. 15Mbit/s
Video Formats: 4:3 Letter Box, 4:3 PanScan, 16 : 9
Video Resolution: 720 x 576i, 720 x 576p, 720 x 480i, 720 x 480p
1280 x 720p, 1920 x 1080i
Audio Decoding: Dolby Digital, MPEG-1 Layer 1,2 and 3
Audio Mode: Stereo/Joint stereo/Mono, Dolby Digital bitstream
Sampling Rate: 32KHz, 44.1KHz and 48KHz(According to input)

Main System
Main Processor: STi chipset 
Memory: Flash-ROM : 32 Mbyte
SDRAM : 192 Mbytes
EEPROM : 128 bytes

Audio / Video & Data IN/OUT
RCA: CVBS Video Output, Audio L, R Output
Component: YPbPr Video Output
HDMI: Video & Audio Output
OPTICAL: Dolby Digital (SPDIF)
RS-232C: 9 pin D-SUB (Male) type, Transfer rate 115Kbps
USB: USB 2.0 Host Support. (5 Vdc 500 mA max.)
Ethernet: RJ45 connector, 100 Mbps

Front Panel
Slot: 2 Common interface PCMCIA slot
1 Smart Card Slot
Display: VFD(Vacuum Fluorescent Display) - 8Digit
Buttons: 3 Buttons (Standby, CH UP/DOWN)

Power Supply
Input Voltage: AC 100 ~ 250V, 50/60Hz
Type: SMPS
Power Consumption: Max. 30W
Protection: Separate Internal Fuse & Lighting protection

Physical Specification
Size (W x H x D): 300mm X 60mm X 230mm
Weight (Net): 1.6 Kg
Operating Temp.: 0°C ~ +45°C
Storage Temp.: -10°C ~ +70°C

* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept