Curs valutar


1 EURO = 4.7305 RON  
1 USD = 4.2682 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc


 » Receptoare de satelit digitale High Definition

Receptor de satelit digital VU Plus Zero4 K

Receptor de satelit digital VU Plus Zero4 K

VU PLUS - VU Plus Zero 4K

Dual core 1.5GHz and 2GB DDR4 realizes faster channel zapping and loading speed.

Entering 4K HDR (High Dynamic Range) era, Colors are now more natural and brighter.

Two tuner types are available : Single DVB-S2X or Single DVB C/T2.

With PLUG, ZERO4K becomes more exquisite.

Alte imagini:
Receptor de satelit digital VU Plus Zero4 KReceptor de satelit digital VU Plus Zero4 KReceptor de satelit digital VU Plus Zero4 KReceptor de satelit digital VU Plus Zero4 K

Pret vechi fara TVA :
623,00 RON

Pret nou fara TVA :
585,00 RON

Pret nou cu TVA :
696,15 RON

Disponibilitate :



Technical specification

  • 1x DVB-S2X or DVB-C/T2
  • Dual Core 1.5GHz
  • 4GB eMMC
  • 2GB DDR4
  • 1 x Common Interface
  • 1x Smart Card
  • 1 x HDMI 2.0
  • HDR 10/HLG
  • 1 x IR sensor
  • 1 x SPDIF : Optical
  • 1 x Ethernet
  • 1 x USB 2.0


Vu+ comparison table


Vu+ Solo2 Zero Zero 4K Uno 4K SE Duo 4K Solo 4K Ultimo 4K
CPU (MHz) 2×1300 742 2×1500 2×1700 4×2100 2×1500 4×1500
RAM (MB) 1024 512 2048 2048 2048 2048 3072
Flash (MB) 256 256 4096 4096 4096 4096 4096
Flash type (NAND) (NAND) eMMC eMMC eMMC eMMC eMMC
DVB 2 x S2 1 x (S2) 1 x S2X or T2/C 1 x Dual FBC DVB-S2X or FBC DVB-C or Dual T2 (Pluggable) 2 x FBC DVB-S/S2X or FBC DVB-C/C V2 or Dual DVB-T2(MTSIF)(Pluggable)  1 x Fixed Dual FBC 1 x Dual S2/C/T/T2 (Pluggable) 2 x Dual FBC DVB-S2 or FBC DVB-C (Pluggable) 1 x Dual DVB-S2 or DVB-C/T2 (Pluggable)
PiP Yes/HD No Yes Yes Yes Yes Yes
Common Interface 1 No 1 1 2 1 2
Smart card 2 1 1 1 1 2 2
USB 3 x 2.0 2 X 2.0 1 x 2.0 2 x 3.0 2 x 3.0 
1 x 2.0
2 x 3.0 
1 x 2.0
2 x 3.0 
1 x 2.0
RS232 Yes Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11)
LAN (Mbit/s) Gigabit 100 100 Gigabit Gigabit Gigabit + WiFi 802.11n(up to 300Mbps) Gigabit
int. HDD 2.5 in No No Detachable 2.5″ 2.5 Detachable 2.5″ 2.5/3.5 in
SCART 1 No No No No No No
HDMI 1 1 1 (2.0) 1 x (2.0) IN 1 x (2.0) OUT 1 x (2.0) IN 
1 x (2.0) OUT
1 x (2.0) 1 x (2.0) IN 
1 x (2.0) OUT
Display VFD Status LED Status LED 2.4″ LCD (240 x 400) 3.5″ Front MiniTV 3.5″ TFT LCD (262 000 / 18bit) 4.0″ Front MiniTV
Other connectors   Composite Video & Analog Audio (1x Jack) Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF, Analogue Audio : Right & Left(Cinch x 2)


Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept