Curs valutar


1 EURO = 4.7432 RON  
1 USD = 4.2921 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Receptoare de satelit digitale High Definition

VU Plus Uno 4K SE

Receptor de satelit digital VU Plus Uno 4K SE

VU PLUS - VU Plus Uno 4K SE

Powerful dual core 1.7GHz CPU and 2GB DDR4
Ensures the maximum performance.With 4K HDR (High Dynamic Range),
UNO 4K SE delivers outstanding picture quality.
Experience real and vivid images.

Alte imagini:
VU Plus Uno 4K SEVU Plus Uno 4K SEVU Plus Uno 4K SE

Pret vechi fara TVA :
1.345,00 RON

Pret nou fara TVA :
1.108,00 RON

Pret nou cu TVA :
1.318,52 RON

Disponibilitate :



technical  specification

  • 1 x Dual FBC DVB-S2 or FBC DVB-C or Dual DVB-T2
  • Dual Core 1.7GHz
  • 4GB eMMC
  • 2GB DDR4
  • 2.4” LCD for Mini TV
  • Detachable 2.5” HDD
  • 1 x Common Interface
  • 1x Smart Card
  • 1 x HDMI 2.0 IN
  • 1 x HDMI 2.0 OUT
  • HDR 10/HLG
  • 1 x IR sensor
  • 1 x SPDIF : Optical
  • 1 x Ethernet
  • 2 x USB 3.0
  • Transcoding
  • UHD Receiver with More Power

    Powerful dual core 1.7GHz CPU and 2GB DDR4 Ensures the maximum performance.


    Unreal video quality with 4K HDR

    With 4K HDR (High Dynamic Range), UNO 4K SE delivers outstanding picture quality. Experience real and vivid images.


    Advanced Pluggable Tuner System supporting one of the three tuner types

    Dual FBC DVB-S2 or,
    FBC DVB-C or,
    Dual DVB-T2


    Mini TV, Smarter Interface

    2.4“ LCD enables a 2nd screen for live TV, Info, and more and more.

     Easy to use detachable HDD

    UNO4K SE comes with a very easy to mount detachable HDD bracket for 2.5” HDD.


Vu+ comparison table

Vu+ Solo2 Zero Zero 4K Uno 4K SE Duo 4K Solo 4K Ultimo 4K
CPU (MHz) 2×1300 742 2×1500 2×1700 4×2100 2×1500 4×1500
RAM (MB) 1024 512 2048 2048 2048 2048 3072
Flash (MB) 256 256 4096 4096 4096 4096 4096
Flash type (NAND) (NAND) eMMC eMMC eMMC eMMC eMMC
DVB 2 x S2 1 x (S2) 1 x S2X or T2/C 1 x Dual FBC DVB-S2X or FBC DVB-C or Dual T2 (Pluggable) 2 x FBC DVB-S/S2X or FBC DVB-C/C V2 or Dual DVB-T2(MTSIF)(Pluggable)  1 x Fixed Dual FBC 1 x Dual S2/C/T/T2 (Pluggable) 2 x Dual FBC DVB-S2 or FBC DVB-C (Pluggable) 1 x Dual DVB-S2 or DVB-C/T2 (Pluggable)
PiP Yes/HD No Yes Yes Yes Yes Yes
Common Interface 1 No 1 1 2 1 2
Smart card 2 1 1 1 1 2 2
USB 3 x 2.0 2 X 2.0 1 x 2.0 2 x 3.0 2 x 3.0 
1 x 2.0
2 x 3.0 
1 x 2.0
2 x 3.0 
1 x 2.0
RS232 Yes Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11)
LAN (Mbit/s) Gigabit 100 100 Gigabit Gigabit Gigabit + WiFi 802.11n(up to 300Mbps) Gigabit
int. HDD 2.5 in No No Detachable 2.5″ 2.5 Detachable 2.5″ 2.5/3.5 in
SCART 1 No No No No No No
HDMI 1 1 1 (2.0) 1 x (2.0) IN 1 x (2.0) OUT 1 x (2.0) IN 
1 x (2.0) OUT
1 x (2.0) 1 x (2.0) IN 
1 x (2.0) OUT
Display VFD Status LED Status LED 2.4″ LCD (240 x 400) 3.5″ Front MiniTV 3.5″ TFT LCD (262 000 / 18bit) 4.0″ Front MiniTV
Other connectors   Composite Video & Analog Audio (1x Jack) Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF, Analogue Audio : Right & Left(Cinch x 2)


Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept