Curs valutar


1 EURO = 4.7769 RON  
1 USD = 4.3418 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


 » Receptoare de satelit digitale High Definition

Vu+ DUO 4K

Receptor de satelit digital VU Plus DUO 4K


  • Quad Core 2.1GHz
  • 1x Dual FBC-S2/S2X tuner
  • Faster booting and channel changingDuo4K is boosted with a high-performance Quad core 2.1GHz CPU and 2GB LPDDR4
  • Two Common Interfaces, two streams simultaneouslyTwo CI descramble two streams at the same time.
  • Detachable 2.5”HDD SlotThe bigger slot(15mm) enables the capacity up to 4TB.
  • Transcoding
  • HDMI In & HDMI Out
  • Detachable 2.5” HDD
  • HDR10/HLG
  • 2 x USB 3.0(Rear) & 1 x USB 2.0(Front)
  • 2 x Common Interface/1x Smart Card
  • 3.5” LCD for Mini TV
  • Advanced tuner system for any possible tuner configurationOne FBC tuner supports 8 demodulators. Two slots make it 16 demodulators totally.
    • Slot A : FBC DVB-S2X, FBC-C V1/V2 and Dual T2(MTISF) Tuner
    • Slot B : FBC DVB-S2X, FBC-C V2 and Dual T2(MTISF) Tuner
    * FBC-C V1 Tuner can only be connected to slot A.
Alte imagini:
Vu+ DUO 4KVu+ DUO 4KVu+ DUO 4KVu+ DUO 4K
Vu+ DUO 4K

Pret fara TVA:
1,545.00 RON

Pret cu TVA :
1.838,55 RON

Disponibilitate :



Technical specification


  • Utmost speed and powerful 2.1GHz Quad Core CPU
  • 1x Dual FBC-S2/S2X tuner (Factory Default)
  • 1 x Smartcard Readers (Xcrypt)
  • 2 x Common Interface
  • 4K UHD Hardware Decoding
  • 2 x Pluggable slots for FBC(Full Band Capture) DVB-S/S2X
    or FBC DVB-C/C V2
    or Dual DVB-T2(MTSIF) Tuner System(up to 8 tuners supported)
  • 2GB LPDDR4 RAM and 4GB eMMC Flash Memory
  • Gigabit Ethernet
  • 2 x USB 3.0(Rear) & 1 x USB 2.0(Front)
  • HDMI 2.0 In & HDMI 2.0 Out
  • RJ11 (RS232 & External IR Sensor)
  • SPDIF for digital bit stream out (optical)
  • Power On/Off Switch
  • EPG Support
  • Automatic & Manual Service Scan supports
  • Multiple LNB control supports
  • Skin change supports
  • Advanced Linux Operating System
  • Various Plug-ins supports
  • 3.5” Front Mini TV
  • The easiest way of Detachable HDD (2.5”)


Front Panel


Display 3.5″ Color LCD Display displaying channel names and program information, pictures and picons or Live TV
USB 2.0 1
Smart card slot 1
Common Interface 2
Key “Standby, Ch +/-, Vol +/-“


Rear Panel

Tuner  2 x Pluggable for FBC(Full Band Capture) DVB-S/S2X or FBC DVB-C/C V2 or Dual DVB- T2(MTSIF) Tuner
Video/Audio output (digital)  1 x HDMI 2.0
Video/Audio input (digital)  1 x HDMI 2.0
Audio output (digital)  Standard optical (SPDIF)
USB 3.0  2
Giga Ethernet  1
RS 232  1



Main voltage  100-240 /50-60 V/Hz
Power consumption (typOperation/ Stand-by)  25W / 0,5W



WLAN  built in (IEEE 802.11 b/g/n/ac 2,4/5GHz)
Bluetooth  built in (Bluetooth 4.1)



RF range DVB-S2X/DVB-C/T2 47-864 MHz(T2/C), 950-2, 150 MHz(S2X)
FEC, de-mutliplexer DVB-S2X/DVB-C/DVB-T2 Standard
Input data rate 2-45 Msymb/s(DVB-S2X), 1-7 Msymb/s(DVB-C)



Video Resolution 576p, 720p, 1080i, 1080p, 2160p
Video decoding H.264/MPEG-4 AVC MVC
S/N >53dB



Sampling rate 32/44.1/48 kHz
S/N >65 dB
Decoding AC3, MPEG-4 (AAC-HE), MPEG-1, Layer 1, 2 and 3



LNB power supply 14V/18V (Max. 400mA)
Control Signal 22kHz;ToneBurst;DiSEqC 1.0/1.1/1.2;USALS



Dimensions (W x D x H) 310 x 241 x 60
Weight (without HDD) 1.65kg
Remote Universal Remote


Vu+ comparison table

Vu+ Solo2 Zero Zero 4K Uno 4K SE Duo 4K Solo 4K Ultimo 4K
CPU (MHz) 2×1300 742 2×1500 2×1700 4×2100 2×1500 4×1500
RAM (MB) 1024 512 2048 2048 2048 2048 3072
Flash (MB) 256 256 4096 4096 4096 4096 4096
Flash type (NAND) (NAND) eMMC eMMC eMMC eMMC eMMC
DVB 2 x S2 1 x (S2) 1 x S2X or T2/C 1 x Dual FBC DVB-S2X or FBC DVB-C or Dual T2 (Pluggable) 2 x FBC DVB-S/S2X or FBC DVB-C/C V2 or Dual DVB-T2(MTSIF)(Pluggable)  1 x Fixed Dual FBC 1 x Dual S2/C/T/T2 (Pluggable) 2 x Dual FBC DVB-S2 or FBC DVB-C (Pluggable) 1 x Dual DVB-S2 or DVB-C/T2 (Pluggable)
PiP Yes/HD No Yes Yes Yes Yes Yes
Common Interface 1 No 1 1 2 1 2
Smart card 2 1 1 1 1 2 2
USB 3 x 2.0 2 X 2.0 1 x 2.0 2 x 3.0 2 x 3.0 
1 x 2.0
2 x 3.0 
1 x 2.0
2 x 3.0 
1 x 2.0
RS232 Yes Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11) Yes (RJ11)
LAN (Mbit/s) Gigabit 100 100 Gigabit Gigabit Gigabit + WiFi 802.11n(up to 300Mbps) Gigabit
int. HDD 2.5 in No No Detachable 2.5″ 2.5 Detachable 2.5″ 2.5/3.5 in
SCART 1 No No No No No No
HDMI 1 1 1 (2.0) 1 x (2.0) IN 1 x (2.0) OUT 1 x (2.0) IN 
1 x (2.0) OUT
1 x (2.0) 1 x (2.0) IN 
1 x (2.0) OUT
Display VFD Status LED Status LED 2.4″ LCD (240 x 400) 3.5″ Front MiniTV 3.5″ TFT LCD (262 000 / 18bit) 4.0″ Front MiniTV
Other connectors   Composite Video & Analog Audio (1x Jack) Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF, Analogue Audio : Right & Left(Cinch x 2)


Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept