Curs valutar


1 EURO = 4.7786 RON  
1 USD = 4.2746 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan


 » Receptoare de satelit digitale High Definition


Receptor de satelit digital UHD 4K


Vu + Ultimo4K, cea mai performanta "nava amiral" Linux 4K de pe piața !!!

  • Receptorul UHD ofera trei plug & play sloturi pentru 2 tunere FBC duble și 1 dublu DVB-S2 sau DVB-C Tuner / T2
  • Un procesor 20000 DMIPS sub suportul HEVC pentru 4K transmițatoare Hood, care promite operarea rapida, comutare rapida ori precum și o mare libertate de mișcare.
  • 2 porturi CI și 2 cititoare de carduri pentru programele criptate
  • Posibilitatea de instalare a HDD intern de 2.5" sau 3.5“
  • 3GB de memorie RAM și 4 GB de memorie flash
  • O intrare HDMI 2.0
  • Conectivitate wireless cu WiFi dual-band inclusiv standardul AC rapid și Bluetooth 4.0.
  • În plus, sistemul de operare Enigma2 ofera funcții avansate TV, de rețea și internet.
Alte imagini:

Pret vechi fara TVA :
2.599,72 RON

Pret nou fara TVA :
2.268,06 RON

Pret nou cu TVA :
2.698,99 RON

Disponibilitate :
La comanda


  • 2 x Common Interface / 2 x Smart Card
  • 1 x Advanced Pluggable Tuner system for Single/Dual DVB-S2/C/T/T2
  • Quad Core 1.5GHz
  • 2 x Advanced Pluggable Tuner system for FBC DVB-S2 (16 Demodulators)
  • 4GB Flash/3GB DDR4
  • 1 x Advanced Pluggable Tuner system for FBC DVB-C (8 Demodulators)
  • 4.0” Front MiniTV
  • 2.5”/3.5” Internal HDD support
  • HDMI 2.0 In/Out
  • 2 x USB 3.0/1 x USB 2.0
  • Wake on Wireless LAN
  • Dual Transcoding
  • AV : 2 x RCA
  • Tuner : 2 x Plug&Play FBC DVB-S2 or 1 x DVB-C
  • RS 232 : 1(External IR Sensor)
  • Tuner : 1 x Plug&Play Single/Dual DVB-S2/C/T/T2
  • SPDIF : Optical
  • HDMI : 2 x HDMI 2.0 In/Out
  • Wlan : IEEE 802.11 b/g/n/ac 2, 4/5GHz
  • 2 x USB 3.0 (+ Front Panel 1 x USB 2.0)
  • CI : 2
  • Ethernet : Gigabit
  • Smart Card : 2

Vu+ comparison table


Vu+ Uno 4K SE Solo 4K DUO 4K Ultimo 4K
CPU (MHz) 2×1700 2×1500 4×2100 4×1500
RAM (MB) 2048 2048 2048 3072
Flash (MB) 4096 4096 4096 4096
Flash type eMMC eMMC eMMC eMMC

1 x Dual FBC DVB-S2X or FBC DVB-C or Dual T2 (Pluggable)

1 x Fixed Dual FBC
1 x Dual S2/C/T/T2

2 x FBC DVB-S/S2X or FBC DVB-C/C V2 or Dual DVBT2 (MTSIF) (Pluggable)

x Dual FBC DVB-S2 or FBC DVB-C (Pluggable)

1 x Dual DVB-S2 or DVB-C/T2 (Pluggable)

HDTV Yes Yes Yes Yes
3D TV Yes Yes Yes Yes
PiP Yes Yes Yes Yes
Common Interface 1 1 2 2
Smart card 1 2 1 2
USB 2 x 3.0 2 x 3.0 & 1 x 2.0 2 x 3.0 & 1 x 2.0 2 x 3.0 & 1 x 2.0
RS232 Yes(RJ11) Yes Yes (RJ11) Yes (RJ11)
LAN (Mbit/s) Gigabit Gigabit + WiFi 802.11n(up to 300Mbps) Gigabit Gigabit
HDD Detachable 2.5″ Detachable 2.5″ Detachable 2.5″ 2.5″/3.5″
eSATA No No No No
HDMI 1 x (2.0) IN 1 x (2.0) OUT 1 x (2.0) 1 x (2.0) IN 
1 x (2.0) OUT
1x(2.0) IN, 1x(2.0) OUT
Display 2.4″ LCD (240 x 400) 3.5″ TFT LCD (262 000 / 18bit) 3.5″ Front MiniTV 4.0″ Front MiniTV
Other connectors

Digital Audio: S/PDIF

Digital Audio : S/PDIF Digital Audio: S/PDIF Digital Audio: S/PDIF,
Analogue Audio : Right & Left(Cinch x 2)
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept