Curs valutar


1 EURO = 4.7432 RON  
1 USD = 4.2921 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Receptoare de satelit digitale High Definition


Receptor de satelit digital Topfield

Topfield - TF7720

Suport pentru MPEG-2, MPEG-4, H.264 compatibil DVB
DiSEqC 1.0, 1.1, 1.2 si USALS(DiSEqC 1.3)
5000 canale (TV si Radio) programabile
Meniu in mai multe limbi
30 Liste favoriti
OSD True-color
Suport subtitrare
Blocare parentala
Upgrade firmware prin USB 2.0
Transfer firmware si date din receptor in receptor
S/PDIF audio digital si AC-3
USB 2.0
Decodare mp3 (MPEG-1 Layer 3)
Iesire Component (YPbPr)

Pret nou fara TVA :
250,00 RON

Pret nou cu TVA :
297,50 RON

Disponibilitate :


  • Features Fully compliant with DVB-S2 (H.264)
  • 2 Common Interfaces for Conax, Cryptoworks, Irdeto, Seca, Viaccess, Etc
  • Multilingual menu, audio and subtitle
  • Teletext 5000 services list
  • 30 favourite service lists
  • S/PDIF for Dolby Digital audio output
  • Component video output (Y/Pb/Pr)
  • USB port for firmware update
  • Specifications:
  • Frequency Range 950 - 2150 MHz
  • Demodulation QPSK
  • Transport Stream ISO/IEC 13818-1
  • MPEG-2, H.264/AVC Profile Level MPEG-2 MP@ML, MP@HL, MPEG-4 H.264/AVC
  • Aspect Ratio 4:3, 16:9
  • Video Resolution 576i, 576p, 720p, 1080i
  • Audio Decoding MPEG-1 Layer 1 & 2, Dolby Downmix
  • HDMI HD Video/Audio Output
  • TV SCART Video CVBS/S-VIDEO/RGB/YPbPr output,
  • Audio L/R output
  • VCR SCART Video CVBS output,
  • Audio L/R output (Input for bypass)
  • S-Video Video S-VIDEO output
  • Component YPbPr output
  • RCA A/V Video CVBS output,
  • Audio L/R output
  • RS-232C max. 115.2Kbps
  • USB 2.0 Host
  • Power Supply 90 - 250VAC, 50/60Hz
  • Power Consumption Running: Max. 23W, Standby: 7W
  • Size (W¡¿H¡¿D) 340 x 60 x 265 mm
  • Weight (Net) 2.44 kg
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept