Curs valutar


1 EURO = 4.8278 RON  
1 USD = 4.4355 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9


 » Receptoare de satelit digitale High Definition

Receptor de satelit digital High Definition Optibox Gekko HD

Receptor de satelit digital High Definition

Optibox - Gekko HD

Receptor de satelit digital High Definition, Optibox Gekko, HDTV PVR Receiver ( H.264/ MPEG4 HD ),  Embedded Linux OS, Xvid file play back supported, Supports MPEG4 /MPEG2 - HD/SD and Fully DVB-S2 /DVB-S Compliant, Intelligent Blind Scan for both SD and HD TV & Multi-Satellite Search, Powerful Extended EPG supports and Event Recording

Alte imagini:
Receptor de satelit digital High Definition Optibox Gekko HDReceptor de satelit digital High Definition Optibox Gekko HDReceptor de satelit digital High Definition Optibox Gekko HDReceptor de satelit digital High Definition Optibox Gekko HD
Receptor de satelit digital High Definition Optibox Gekko HD

Pret nou fara TVA :
269,47 RON

Pret nou cu TVA :
320,67 RON

Disponibilitate :

Optibox Gekko HD - High Definition Digital Satellite Receiver
Main Features:
  • Supports MPEG4 /MPEG2 - HD/SD and Fully DVB-S2 /DVB-S Compliant
  • Intelligent Blind Scan for both SD and HD TV & Multi-Satellite Search
  • Multi-LNB Controlled by DiSEqC Control Version 1.0, 1.1, 1.2 and USALS
  • HDTV PVR Receiver ( H.264/ MPEG4 HD )
  • Embedded Linux OS
  • Time Shifting, Recording & Playback with External HDD (USB 2.0)
  • Simultaneously Records of Services and allows Watching 2 others (PIP)
  • Powerful Extended EPG supports and Event Recording
  • One USB 2.0 Host ports (MP3 Player & JPEG Viewer)
  • Xvid file play back supported
  • Ethernet port Supported
  • On-Screen Display with Full Color & Resolution
  • Favorite Groups
  • Powerful Service List Manager for Favorites, Lock, Skip, Move, Edit and Delete
  • Service Sorting by Alphabet, Transponder and CAS
  • User Friendly & Multi-language Supported (OSD & Menu)
  • Teletext / Subtitle Supported
  • Maximum 10,000 Services(TV & Radio) Programmable
  • Picture-in-Picture (PIP) & Multi-picture Display
  • Parental Lock / System Lock / Installation Lock
  • HDMI Video & Audio Output (576i, 576p, 720p, 1080i, 1080p)
  • CVBS(composite) Video & Audio Output via RCA
  • CVBS, RGB, Video & Audio Output via TV SCART
  • Optical Output for Digital Audio(SPDIF)
  • Software & Service channel Database upgrade via USB & RS-232C port
  • 1 Smart card reader and 1 Common Interface Slots
  • 1W Stand-by Power Consumption
Tuner & Channel Decoder:
Input Connector: F-type, IEC 169-24, Female
Loop through out: F-type, IEC 169-24, Female
Frequency Range: 950MHz ~ 2150MHz
Input Impedance: 75Ohm, unbalanced
Signal Level: -65 to -25dBm
LNB Power: 13/18VDC, max.400mA
22KHz Tone: (22±2)KHz, (0.6±0.2)V
DiSEqC Control: V1.0/1.2/USALS Compatible
Demodulation: QPSK / 8PSK
Input Symbol Rate: 2 ~ 45 Ms/s(QPSK of DVB-S)
2 ~ 45 Ms/s(QPSK of DVB-S2)
2 ~ 35 Ms/s(8PSK of DVB-S2)
FEC Decoder: 1/2, 2/3, 3/4, 5/6 and 7/8 with
Constraint Length K=7(DVB-S)
1/2, 3/5, 2/3, 3/4, 4/5, 5/6, 8/9 and 9/10 (DVB-S2/QPSK)
3/5, 2/3, 3/4, 5/6, 8/9, 9/10(DVB-S2/8PSK)
MPEG Transport Stream A/V Decoding
Transport Stream: H.264(MPEG-4 part 10, MPEG-4/AVC and H26L)
MPEG-II ISO/IEC 13818-2/11172-2
Profile Level: MPEG-4/AVC MP@L4, MPEG-II MP@HL
Input Rate: Max. 80Mbit/s
Video Formats: 4:3 Letter Box, 4:3 PanScan, 16 : 9
Video Resolution: 720 x 576i, 720 x 576p, 720 x 480i, 720 x 480p
1280 x 720p, 1920 x 1080i, 1920 x 1080p(supports only HDMI)
Audio Decoding: Dolby Digital, MPEG-1 Layer 1,2 and 3
Audio Mode: Stereo/Joint stereo/Mono, Dolby Digital bitstream
Sampling Rate: 32KHz, 44.1KHz and 48KHz(According to input)
Main System
Main Processor: STi chipset
Flash-ROM : 32 Mbyte
SDRAM : 256 Mbytes
EEPROM : 256 bytes
Audio / Video & Data IN/OUT
RCA: Video & Audio Output (Jack Type)
OPTIC: Dolby Digital (SPDIF)
RS-232C: 9 pin D-SUB (Male) type, Transfer rate 115Kbps
USB: USB 2.0 Host Front & Rear Support. (5V DC 500 mA Max.)
Ethernet: RJ45 connector, 100 Mbps
1 Common interface PCMCIA slot
1 Smart Card Slot
Front Pane
Buttons: 3 Buttons (Standby, CH UP/DOWN)
Power Supply
Input Voltage: AC 100 ~ 250V, 50/60Hz
Power Consumption: Max. 30W
Standby Power: Max. 1W
Physical Specification
Size (W x H x D): 220mm X 43mm X 180mm
Weight (Net): 1.1 Kg
Operating Temp.: 0°C ~ +45°C
Storage Temp.: -10°C ~ +70°C
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept