Curs valutar


1 EURO = 4.7204 RON  
1 USD = 4.2231 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc


 » Receptoare de satelit digitale High Definition

Amiko 8250

Receptor de satelit digital High Definition CICXE PVR

Amiko - AMIKO HD8250+

  • Conax Embedded Card Reader
  • Common Interface
  • MKV, AVI, MPEG, TS, VOB, MP3, JPEG Playback
  • Channel Recording to External Storage Devices
  • Full HD 1080p Output
  • YouTube Videos
  • Ethernet Connection & USB WiFi Support (Ralink RT5370 chip only)
  • Two High Speed USB2.0 Slots
Alte imagini:
Amiko 8250Amiko 8250Amiko 8250Amiko 8250

Pret vechi fara TVA :
241,00 RON

Pret nou fara TVA :
199,00 RON

Pret nou cu TVA :
236,81 RON

Disponibilitate :


  • One Conax Embedded card reader
  • One Common Interface slot
  • 6000 channels (TV and Radio) programmable
  • Stream TV & Radio channels to your Android devices via local network! Click here for the App!
  • Two High Speed USB 2.0 Connections
  • Ethernet Connection & USB WiFi Support (Ralink RT5370 chip only)
  • YouTube videos
  • RSS Reader & Weather Forecast Functions (Ethernet or WiFi connection required)
  • Channel Streaming via local network to Android Phones & Tablets
  • Channel Recording to External Storage Devices (optional)
  • Timeshift support
  • Channel Recording & Timeshifting Simulteniously (optional)
  • Channel switching time less than 1 second
  • True-color, User Friendly On-Screen Display (OSD)
  • Full Picture In Graphic (PIG) function
  • Electronic Program Guide (EPG) for on screen channel information
  • Subtitle supported
  • Teletext supported by VBI insertion and software emulation
  • Parental lock facility by channel and program event
  • Program and Channel information transfer from receiver to receiver
  • Satellite Blind Scan & Fast Scansupport
  • Unicable Support
  • DiSEqC 1.0, 1.1, 1.2 and USALS Compatible
  • Full HD (1080p) Output via HDMI
  • Exciting games embedded
  • Multi-Language support
  • Software upgrade support via USB, Network, RS232
  • Power Consumption in Stand-By: <0.5W


Tuner & Demodulation
Tuner Type: DVB-S / DVB-S2
Input Connector: F-type, Connector, Female
Signal Level: -65 to -25 dBm
LNB Power & Polarization: Vertical: +13V/+14V,
Horizontal: +18V/+19V
Current: Max. 400mA (Overload Protection)
22KHz Tone Frequency: 22±1KHz
DiSEqC Control: Version 1.0, 1.1, 1.2, USALS
Demodulation: QPSK, 8PSK
Input Symbol Rate: 2-45 Mbps,
FEC: 1/2, 2/3, 3/4, 5/6, 7/8 and Auto

System Resources
Main Processor: Dual Core 600MHz CPU
Flash Memory: 16MB

MPEG TS A/V Decoding
Transport Stream: MPEG-2, H.264
Input Rate: Max.120Mbit/s
Aspect Radio: 4:3, 16:9, Letter Box
Video Decoding: MPEG-2, MP@ML, MPEG-4 part 10/H264
Video Resolution: 720*480P/I, 720*576P/I, 1280*720p, 1920*1080i, 1920*1080p
Audio Decoding: MPEG-1 layer I/II, MPEG-2 layer II, Dolby digital
Audio Mode: Left / Right / Stereo/ Mono
Sampling Rate: 32, 44.1 and 48KHz

Power Supply
Input Voltage: Free Voltage (100-250V AC 50/60Hz)
Power Consumption: 30W Max
Stand-By Power Consumption: <0.5W

A/V & Data Input/Output
RCA A/V: Video CVBS output, Audio L/R output
RS-232C: Transfer rate 115.2Kbps, 9 pin D-sub Type
USB: Two USB 2.0 slots
S/PDIF: Optical
HDMI: VER1.4, Type A
Ethernet: 10/100M RJ45
0/12V: 50mA max

Physical Specifications
Size[W*H*D]: 220mm*40mm*160mm
Net Weight: 1.0KG
Operation Temperature: 0°C~+45°C
Storage Temperature: -10°C~+70°C
Storage Humidity: 5%~95% RH (Non-Condensing)

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept