Curs valutar


1 EURO = 4.7788 RON  
1 USD = 4.3105 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


 » Receptoare de satelit digitale High Definition

VU+ Zero fata

Receptor de satelit digital HD

VU PLUS - Vu+ Zero

There was one goal in developing ZERO from the beginning. Let’s make something more affordable to please more Vu+ fans. As the name stands for, suggests, ZERO is a remarkably competitive model pricewise while maintaining the performance and philosophy of Vu+ products.

This is why ZERO is the most affordable DVB-S2 HD Zapper of Vu+ ever.

Alte imagini:
VU+ ZeroVU+ Zero spateVU+ Zero albVU+ Zero alb
VU+ seria

Pret vechi fara TVA :
468,65 RON

Pret nou fara TVA :
415,50 RON

Pret nou cu TVA :
494,45 RON

Disponibilitate :

Affordable DVB-S2 HD Zapper

There was one goal in developing ZERO from the beginning. Let’s make something more affordable to please more Vu+ fans. As the name suggests, the end user price of ZERO is a remarkably competitive while maintaining the performance and philosophy of Vu+ products. This is why ZERO is priced at 100 Euro without VAT. It is the most affordable DVB-S2 HD Zapper of Vu+ ever.


Powerful Features

It was certainly a challenging task to increase the affordability while not losing the performance that Vu+ pursues. So, ZERO comes with a dual core of 2000 DMIPSpowerful enough to support all demanding multimedia functions. Despite of its compact and slim design, all important connectors are nicely equipped as below.


Slim & Elegant Design

ZERO characterizes the design philosophy of Vu+. Its elegant external design is stunningly standing out among those monotonous and tasteless set top boxes in the market. ZERO’s beauty deserves to be placed right next to your TV. ZERO comes in black and white.


An Ideal Solution as a 2nd Vu+ Set Top Box

ZERO is a smart choice for those using HDD integrated Vu+ models like SOLO2 and DUO2. Let’s assume you use ZERO in your room. Once connected in your home network, you can play multimedia contents stored in DUO2 or SOLO2in the living room. ZERO is definitely the most ideal solution for your second set top box.


Technical Specification

  • CPU (MIPS) 742MHz
  • 512MB Ram
  • 256MB Flash (NAND)
  • 1x DVB-S2 tuner
  • 1x Smart Card
  • 2x USB
  • 1x RS232
  • 1x LAN (100Mbit)
  • 1x HDMI
  • 1x S/PDIF
  • 1x Composite Video
  • 1x Analog Audio (Stereo Jack)
  • PiP (Picture in Picture)
  • HDTV
  • LED Status Display


Vu+ comparison table


Vu+ Duo2 Solo Solo2 SoloSE SoloSE V2 Zero Solo 4K
CPU (MHz) 2×1300 333* 2×1300 2×1300 2×1300 742 2×1500
RAM (MB) 2048 256 1024 1024 1024 512 2048
Flash (MB) 1024 128 256 256 512 256 4096
Flash type (NAND) (NAND) (NAND) (NAND) (NAND) (NAND) eMMC
DVB 2 x S2/C/T2
1 x S2 2 x S2 1 x S2/C/T/T2
1 x Dual S2/C/T/T2
1 x (S2) 1 x Fixed Dual FBC
1 x Dual S2/C/T/T2
HDTV Yes Yes Yes Yes Yes Yes Yes
3D TV Yes Yes Yes Yes Yes Yes Yes
PiP Yes No Yes/HD Yes Yes No Yes
Common Interface 2 2 1 1 1 No 1
Smart card 2 1 2 1 1 1 2
USB 3 x 2.0 2 x 2.0 3 x 2.0 2 x 2.0 2 x 2.0 2 X 2.0 2 x 3.0 & 1 x 2.0
RS232 Yes Yes Yes Yes Yes Yes Yes
LAN (Mbit/s) Gigabit + WiFi 802.11n(up to 300Mbps) 100 Gigabit 100 100 100 Gigabit + WiFi 802.11n(up to 300Mbps)
HDD 2.5/3.5 in No 2.5 in No No No Detachable 2.5″
eSATA Yes No No Yes Yes No No
SCART 1 1 1 No No No No
HDMI 1 1 1 1 1 1 1 x (2.0)
Display 3.2″ TFT LCD (65 536 / 16bit) No VFD Status LED Status LED Status LED 3.5″ TFT LCD (262 000 / 18bit)
Other connectors Digital Audio:S/PDIF, Analogue Audio:Right & Left (Cinch x 2), Analogue Video: Component Video (YPbPr), Composite Video (Cinch x 1 ) 1 x YPrPb   Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 ) Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 ) Composite Video & Analog Audio (Stereo Jack X 1) Digital Audio: S/PDIF
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept