Curs valutar

17-Jul-2019

1 EURO = 4.7340 RON  
1 USD = 4.2129 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic

ANPC

 » Receptoare de satelit digitale High Definition



Vu+ Solo SE V2

Receptor de satelit digital HD

VU PLUS - Vu+ SOLO SE V2

  • Powerful Dual Core CPU 1.3GHz
  • SOLO SE is equipped with dual core CPU 1.3 GHz, boasting the highest performance amongst all HD zappers on the market.You will be amazed with the faster booting speed, faster zapping, and faster software loading and a lot more.

 

Alte imagini:
Vu+ Solo SE V2Vu+ Solo SE V2Vu+ Solo SE V2Vu+ Solo SE V2
 
Vu+ Solo SE V2Vu+ Solo SE V2Vu+ Solo SE V2Vu+ Solo SE V2


Pret nou fara TVA :
432,00 RON

Pret nou cu TVA :
514,08 RON

Disponibilitate :
Sunati

CEL MAI MIC PRET DE PE PIATA !!!

Produs original fabricat in Korea

Optionale:

Vu+ DVB-S2 tuner

Vu+ DVB-C/T/T2 tuner

Vu+ DVB-S2 Twin tuner

 

Technical specification 

Powerful Dual Core CPU 1.3GHz

SOLO SE is equipped with dual core CPU 1.3 GHz, boasting the highest performance amongst all HD zappers on the market. You will be amazed with the faster booting speed, faster zapping, and faster software loading and a lot more.

 

Advanced Pluggable Tuner System designed for Dual DVB-S2/C/T/T2 Tuner

SOLO SE V2 indicates pluggable tuner system with the availability of using Dual DVB-S2/C/T/T2 tuner from Version 2. Moreover, as its tuner system is not only for Dual DVB-S2 but also Dual DVB-C/T2, your choice of watching TV will be even more fulfilling.

 

NEW!!! 1GB DRAM / 512MB FLASH

Along with the powerful dual core CPU, from SOLO SE V2 has even bigger memory of 1GB DRAM and 512MB FLASH to ensure the extra-maximum performance.

 

Support for the latest TV applications

Like all other Vu+ models, SOLO SE supports the latest HbbTV specifications as well as TV apps like YouTube (lean-back version). With SOLO SE, your TV becomes faster, smarter, and more fun.

 

Features & Functions
• SoloSEV2
• CPU Type: MIPS
• CPU (MHz): 2x1300
• RAM (MB): 1024
• Flash (MB): 512
• Flash type:(NAND)
• DVB: 1 X S2/C/T/T2
• HDTV: Yes
• 3D TV: Yes
• PiP: Yes
• Common Interface: 1
• Smart card: 1
• USB: 2 x 2.0
• RS232: Yes
• LAN (Mbit/s): 100
• HDD: No
• ATA: Yes
• eSATA: No
• SCART: No
• HDMI: 1
• Display: Status LED
• Other connectors: Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 )


Vu+ comparison table
 

 

Vu+ Duo2 Solo Solo2 SoloSE SoloSE V2 Zero Solo 4K
CPU Type MIPS MIPS MIPS MIPS MIPS MIPS ARM
CPU (MHz) 2×1300 333* 2×1300 2×1300 2×1300 742 2×1500
RAM (MB) 2048 256 1024 1024 1024 512 2048
Flash (MB) 1024 128 256 256 512 256 4096
Flash type (NAND) (NAND) (NAND) (NAND) (NAND) (NAND) eMMC
DVB 2 x S2/C/T2
(Pluggable)
1 x S2 2 x S2 1 x S2/C/T/T2
(Pluggable)
1 x Dual S2/C/T/T2
(Pluggable)
1 x (S2) 1 x Fixed Dual FBC
1 x Dual S2/C/T/T2
(Pluggable)
HDTV Yes Yes Yes Yes Yes Yes Yes
3D TV Yes Yes Yes Yes Yes Yes Yes
PiP Yes No Yes/HD Yes Yes No Yes
Common Interface 2 2 1 1 1 No 1
Smart card 2 1 2 1 1 1 2
USB 3 x 2.0 2 x 2.0 3 x 2.0 2 x 2.0 2 x 2.0 2 X 2.0 2 x 3.0 & 1 x 2.0
RS232 Yes Yes Yes Yes Yes Yes Yes
LAN (Mbit/s) Gigabit + WiFi 802.11n(up to 300Mbps) 100 Gigabit 100 100 100 Gigabit + WiFi 802.11n(up to 300Mbps)
HDD 2.5/3.5 in No 2.5 in No No No Detachable 2.5″
ATA SATA III No SATA III No No No SATA
eSATA Yes No No Yes Yes No No
SCART 1 1 1 No No No No
HDMI 1 1 1 1 1 1 1 x (2.0)
Display 3.2″ TFT LCD (65 536 / 16bit) No VFD Status LED Status LED Status LED 3.5″ TFT LCD (262 000 / 18bit)
Other connectors Digital Audio:S/PDIF, Analogue Audio:Right & Left (Cinch x 2), Analogue Video: Component Video (YPbPr), Composite Video (Cinch x 1 ) 1 x YPrPb   Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 ) Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 ) Composite Video & Analog Audio (Stereo Jack X 1) Digital Audio: S/PDIF
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept