Curs valutar


1 EURO = 4.8314 RON  
1 USD = 4.4445 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9


 » Receptoare de satelit digitale High Definition

Vu+ Solo SE V2

Receptor de satelit digital HD


  • Powerful Dual Core CPU 1.3GHz
  • SOLO SE is equipped with dual core CPU 1.3 GHz, boasting the highest performance amongst all HD zappers on the market.You will be amazed with the faster booting speed, faster zapping, and faster software loading and a lot more.


Alte imagini:
Vu+ Solo SE V2Vu+ Solo SE V2Vu+ Solo SE V2Vu+ Solo SE V2
Vu+ Solo SE V2Vu+ Solo SE V2Vu+ Solo SE V2Vu+ Solo SE V2

Pret nou fara TVA :
458,31 RON

Pret nou cu TVA :
545,39 RON

Disponibilitate :


Produs original fabricat in Korea


Vu+ DVB-S2 tuner

Vu+ DVB-C/T/T2 tuner

Vu+ DVB-S2 Twin tuner


Technical specification 

Powerful Dual Core CPU 1.3GHz

SOLO SE is equipped with dual core CPU 1.3 GHz, boasting the highest performance amongst all HD zappers on the market. You will be amazed with the faster booting speed, faster zapping, and faster software loading and a lot more.


Advanced Pluggable Tuner System designed for Dual DVB-S2/C/T/T2 Tuner

SOLO SE V2 indicates pluggable tuner system with the availability of using Dual DVB-S2/C/T/T2 tuner from Version 2. Moreover, as its tuner system is not only for Dual DVB-S2 but also Dual DVB-C/T2, your choice of watching TV will be even more fulfilling.



Along with the powerful dual core CPU, from SOLO SE V2 has even bigger memory of 1GB DRAM and 512MB FLASH to ensure the extra-maximum performance.


Support for the latest TV applications

Like all other Vu+ models, SOLO SE supports the latest HbbTV specifications as well as TV apps like YouTube (lean-back version). With SOLO SE, your TV becomes faster, smarter, and more fun.


Features & Functions
• SoloSEV2
• CPU Type: MIPS
• CPU (MHz): 2x1300
• RAM (MB): 1024
• Flash (MB): 512
• Flash type:(NAND)
• DVB: 1 X S2/C/T/T2
• HDTV: Yes
• 3D TV: Yes
• PiP: Yes
• Common Interface: 1
• Smart card: 1
• USB: 2 x 2.0
• RS232: Yes
• LAN (Mbit/s): 100
• HDD: No
• ATA: Yes
• eSATA: No
• HDMI: 1
• Display: Status LED
• Other connectors: Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 )

Vu+ comparison table


Vu+ Duo2 Solo Solo2 SoloSE SoloSE V2 Zero Solo 4K
CPU (MHz) 2×1300 333* 2×1300 2×1300 2×1300 742 2×1500
RAM (MB) 2048 256 1024 1024 1024 512 2048
Flash (MB) 1024 128 256 256 512 256 4096
Flash type (NAND) (NAND) (NAND) (NAND) (NAND) (NAND) eMMC
DVB 2 x S2/C/T2
1 x S2 2 x S2 1 x S2/C/T/T2
1 x Dual S2/C/T/T2
1 x (S2) 1 x Fixed Dual FBC
1 x Dual S2/C/T/T2
HDTV Yes Yes Yes Yes Yes Yes Yes
3D TV Yes Yes Yes Yes Yes Yes Yes
PiP Yes No Yes/HD Yes Yes No Yes
Common Interface 2 2 1 1 1 No 1
Smart card 2 1 2 1 1 1 2
USB 3 x 2.0 2 x 2.0 3 x 2.0 2 x 2.0 2 x 2.0 2 X 2.0 2 x 3.0 & 1 x 2.0
RS232 Yes Yes Yes Yes Yes Yes Yes
LAN (Mbit/s) Gigabit + WiFi 802.11n(up to 300Mbps) 100 Gigabit 100 100 100 Gigabit + WiFi 802.11n(up to 300Mbps)
HDD 2.5/3.5 in No 2.5 in No No No Detachable 2.5″
eSATA Yes No No Yes Yes No No
SCART 1 1 1 No No No No
HDMI 1 1 1 1 1 1 1 x (2.0)
Display 3.2″ TFT LCD (65 536 / 16bit) No VFD Status LED Status LED Status LED 3.5″ TFT LCD (262 000 / 18bit)
Other connectors Digital Audio:S/PDIF, Analogue Audio:Right & Left (Cinch x 2), Analogue Video: Component Video (YPbPr), Composite Video (Cinch x 1 ) 1 x YPrPb   Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 ) Digital Audio : S/PDIF, Analogue Audio : Right & Left(Cinch x 2) Composite Video (Cinch x 1 ) Composite Video & Analog Audio (Stereo Jack X 1) Digital Audio: S/PDIF
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept