Curs valutar

18-Jul-2019

1 EURO = 4.7345 RON  
1 USD = 4.2201 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic

ANPC

 » Receptoare de satelit digitale High Definition



ML1200 Fata

Receptor de satelit cu cititor Card, HD IPTV STALKER Multimedia

Medialink - ML1200S

Cel mai versatil Receptor de satelit Medi@Link High Definition cu 1 Smart Card reader, BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player,
INTERNET RADIO
conexiune ethernet 10/100 SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p
Placa de retea RJ45 este integrata.

Alte imagini:
ML1200 SpateML1200





Pret vechi fara TVA :
210,00 RON


Pret nou fara TVA :
179,00 RON

Pret nou cu TVA :
213,01 RON

Disponibilitate :
Sunati

Optional, stick WiFi USB compatibil AICI

 

Actualizare firmware AICI

 

ML 1200 S - Smart HOME  S2 1 card Premium  + IPTV

MAIN CHIPSET

CPU

High-Performance CPU 667MHz

32-bit MIPS 24KEc

 

MEMORY

FLASH memory

128Mb

DDR3 SDRAM

2 Gb

 

SATELLITE TUNER

NUMBER OF TUNERS

1

INPUT CONNECTOR

F-Type, IEC 169-24, Female

INPUT FREQUENCY RANGE

950MHz ~ 2150MHz

INPUT SIGNAL LEVEL

-65dBm ∼ -25dBm

CONNECTOR

75Ω Unbalanced

INPUT IMPEDANCE

Vertical: +13.5V (+14.5V at high voltage)

Horizontal: +18V (+18.5V at high voltage)

Current: Max. 500mA (Short Circuit Protection)

22KHz TONE

Frequency 22KHz±4KHZ

Amplitude 0.6±0.2Vpp

DiSEqC CONTROL

1.0, 1.1 & 1.2 Version Compliant

CHANNEL SELECTION

PLL Frequency Synthesizer

 

DEMODULATORS/S2

TYPE

DVB-S, DVB-S2,

DEMODULATION

QPSK, 8PSK

INPUT SYMBOL RATE

1~45MS/s, SCPC and MCPC Capable

FEC MODE

DVB-S: Auto, 1/2, 2/3, 3/4, 5/6, 7/8

DVB-S2,

- QPSK: Auto, 1/2, 3/5, 2/3, 4/5, 5/6, 8/9, 9/10

- 8PSK: Auto, 3/5, 2/3, 3/4, 5/6, 8/9, 9/10

 

VIDEO DECODER

TRANSPORT STREAM

MPEG-2 ISO/IEC 13818-2

MPEG-4 Part 2

PROFILE LEVEL

MPEG-2 MP@ML, MPEG-2 MP@HL

MPEG-4 AVC/H.264 HP@L4.1

VIDEO FORMAT

4:3, 16:9, Letter Box

VIDEO RESOLUTION

1080p, 1080i, 720p, 576p, 576i, 480p, 480i

 

AUDIO DECODER

AUDIO DECODING

MPEG/MusiCam Layer I & II, AC3 Down Mix

AUDIO MODE

Mono / Dual / Joint Stereo / Stereo

AUDIO BIT RATE

32Kbits/s – 384Kbits/s

 

AUDIO / VIDEO / DATA INPUT/OUTPUT

VIDEO OUTPUT

1 x RCA Cinch

AUDIO OUTPUT

2 x RCA Cinch (L/R)

DIGITAL AUDIO OUTPUT

1 x S/PDIF Cinch

RS-232C

9 Pin D-Sub Socket Type (Max.115200bps)

HDMI

1 x HDMI 1.3

USB

2 x (USB 2.0 Host), Front & Rear

POWER SUPPLY

TYPE

External 12V, 2A

PROTECTION

Separate internal fuse

The input should be protected against lighting.

     

 

PHYSICAL CHARACTERISTICS

DIMENSION (W x H x D)

180 x 3 x 125 (mm)

NET WEIGHT

Approx. 0.7 kg

OPERATING TEMPERATURE

0℃ to +45℃

STORAGE TEMPERATURE

-10℃ to +70℃

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept