Curs valutar


1 EURO = 4.7305 RON  
1 USD = 4.2682 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc


 » Receptoare de satelit digitale High Definition

Amiko Micro HD SE

Receptor de satelit High Definition de dimensiuni reduse


Receptor de satelit High Definition de dimensiuni reduse cu media player, card reader Conax si conexiune ethernet, senzor IR extern, redare mkv,avi,mpeg,ts,vob,mp3,jpeg, Iesire Full HD 1080p

Alte imagini:
Amiko Micro HD SEAmiko Micro HD SEAmiko Micro HD SEAmiko Micro HD SE - Telecomanda
Amiko Micro HD SE - Functii

Pret vechi fara TVA :
164,00 RON

Pret nou fara TVA :
127,00 RON

Pret nou cu TVA :
151,13 RON

Disponibilitate :


  • Compact design
  • Mountable on TV’s back, or on wall
  • External IR sensor (included in the package)
  • Embedded card reader
  • Two High speed USB 2.0 connections
  • Multimedia playback
  • Stream TV & Radio channels to your Android devices via local network! Click here for more info!
  • Ethernet & USB WiFi connection support (Ralink RT5370 chip)
  • YouTube, Weather Forecast & RSS Reader functions
  • Full HD 1080p output through HDMI
  • Jack type analogue RCA output
  • DiSEqC 1.0, 1.1, 1.2 and USALS Compatible
  • Easy software upgrades through USB or network
  • Easy database & settings transfers through USB
  • Less than 0.5W power consumption in stand-by mode
  • 12V DC power - ideal for camping and traveling

System Resources

Main Processor: 400MHz based CPU
Flash Memory: 64MBits
DDR RAM: 1024Mbits

MPEG TS A/V Decoding

Transport Stream: MPEG-2, MPEG-4 (H.264)
Input Rate: Max.120Mbit/s
Aspect Radio: 4:3, 16:9, Letter Box
Video Decoding: MPEG-2, MP@ML, MPEG-4 part 10/H264
Video Resolution: 720*480p/i, 720*576p/i, 1280*720p, 1920*1080p/i 
Audio Decoding: MPEG-1 layer I/II, MPEG-2 layer II, Dolby Digital
Audio Mode: Left / Right / Stereo/ Mono
Sampling Rate: 32, 44.1 and 48KHz

A/V & Data Input/Output

AV OUT: Video CVBS output, Audio L/R output (Jack Type)
LAN: RJ-45 Ethernet Connection
RS-232C: Transfer rate 115.2Kbps, (Jack Type)
IR IN: External IR Connection (Jack Type)
USB: Two USB 2.0 slots
HDMI: VER1.3, Type A, Dolby Digital Bit-Stream Output

Tuner & Demodulation

Tuner Type: DVB-S2
Input Connector: F-type, Connector, Female
Signal Level: -65 to -25 dBm
LNB Power: Vertical: +13V/+14V,
Horizontal: +18V/+19V
Current: Max. 350mA
Overload Protection
22K Tone Frequency: 22±1KHz
DiSEqC Control: Version 1.0, 1.1, 1.2, USALS
Demodulation: QPSK, 8PSK
Input Symbol Rate: 2-45 Mbps,
FEC: 1/2, 2/3, 3/4, 5/6, 7/8 and Auto

Physical Specifications

Size[W*H*D]: 75 mm * 115 mm * 22 mm
Net Weight: 0.25 Kg
Operation Temperature: 0°C~+45°C
Storage Temperature: -10°C~+70°C
Storage Humidity: 5%~95% RH (Non-Condensing)

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept