Curs valutar

22-Nov-2019

1 EURO = 4.7808 RON  
1 USD = 4.3144 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavecablu utpstabilizator de tensiuneswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolodoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpower

ANPC

 » Receptoare de satelit digitale High Definition



ML6200S

Receptor de satelit H.265 HEVC cu cititor de Card HD IPTV STALKER Multimedia

Medialink - ML6200S

Cel mai nou receptor de satelit Medi@Link cu compresie H.265 HEVC cu 1 Smart Card reader, BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player,
INTERNET RADIO
conexiune ethernet 10/100 SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p
Placa de retea RJ45 este integrata.

Alte imagini:
ML6200SML6200SML6200S





Pret vechi fara TVA :
298,00 RON


Pret nou fara TVA :
219,00 RON

Pret nou cu TVA :
260,61 RON

Disponibilitate :
Sunati

Optional, stick WiFi USB compatibil AICI

 

Actualizare firmware AICI

 

 

MAIN CHIPSET 
CPU  High-Performance 667MHz 32-bit MIPS 24KEc 
MEMORY  
FLASH MEMORY  128Mb 
DDR3 SDRAM   2Gb RAM 
DVB-S2   
INPUT FREQUENCY RANGE  950MHz ~ 2150MHz, ANT IN 
INPUT/OUTPUT CONNECTOR  F-Type, IEC 169-24 and Female 
INPUT FREQUENCY RANGE  950MHz ~ 2150MHz, ANT IN
INPUT SIGNAL LEVEL  -65dBm ∼ -25dBm 
INPUT IMPEDANCE  75Ω Unbalanced 
INPUT VOLTAGE  Vertical: +13.5V (+14.5V at high voltage) 
  Horizontal: +18V (+18.5V at high voltage) 
  Current: Max. 500mA (Short Circuit Protection) 
22KHz TONE  Frequency 22KHz±4KHZ 
  Amplitude 0.6±0.2Vpp 
DiSEqC CONTROL  1.0, 1.1 & 1.2 Version Compliant 
CHANNEL SELECTION  PLL Frequency Synthesizer 
VIDEO DECODER 
TRANSPORT STREAM  MPEG-2 ISO/IEC 13818-2 
  MPEG-4 Part 2 
PROFILE LEVEL  MPEG-2 MP@ML, MPEG-2 MP@HL 
  MPEG-4 AVC/H.264 HP@L4.1 , H.265 HEVC 
VIDEO FORMAT  4:3, 16:9, Letter Box 
VIDEO RESOLUTION  1080p, 1080i, 720p, 576p, 576i, 480p, 480i 
AUDIO DECODER 
AUDIO DECODING  MPEG/MusiCam Layer I & II, AC3 Down Mix 
AUDIO MODE  Mono / Dual / Joint Stereo / Stereo 
AUDIO BIT RATE  32Kbits/s – 384Kbits/s 
SAMPLING FREQUENCY  32, 44.1, 48KHz 
AUDIO / VIDEO / DATA INPUT/OUTPUT  
HD Out  1 x HD Out 
USB  2 x (USB 2.0 Host), Front & Rear  
USB-WiFi    USB WiFi support 
S/PDIF  Digital Audio 
Ethernet  LAN for RJ-45 
 POWER SUPPLY 
INPUT VOLTAGE  DC 12V 2A 
TYPE  Adapter Type 
PROTECTION  Separate internal fuse  
  The input should be protected against lighting. 
PHYSICAL CHARACTERISTICS 
DIMENSION (W x H x D)  220 x 40 x 120 (mm) 
NET WEIGHT  Approx. 1.0Kg 
OPERATING TEMPERATURE  0℃ to +45℃ 
STORAGE TEMPERATURE  (-10℃ to +70℃

 

 

 

 

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept