Curs valutar

09-Aug-2020

1 EURO = 4.8375 RON  
1 USD = 4.0949 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobilamesh3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfanextender3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4kseoutdoor650ups120060001000010kvausbepscentrala5ghzfemalegigaethernetmiraac1200om1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gaming20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetallitatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszhtooless>qrg11>xtrg11cu-mxtrg6uxtrg6mxtrg11mxtprg11cupextrg11pvcxtrg6m/txtrg6/txtrg11m/txtrg6u100xtrg6lszhxtrg11/tbgrg6ubgrg6/tbgrg6mbgrg6m/tbgrg11mbgrg11m/tbgrg6lszhbgrg6/tlszh802.3bt

ANPC

Inapoi



7700HDCICX

Receptor de Satelit High Definition

Opticum - 7700HDCICX

Digital HD receiver with full options, CARD READER and Common Interface, output, cable included






Pret vechi fara TVA :
843,42 RON


Pret nou fara TVA :
159,14 RON

Pret nou cu TVA :
189,37 RON

Disponibilitate :
Sunati

GLOBO Opticum 7700HD CICX - HDTV DIGITAL RECEIVER with 2 COMMON INTERFACE and 1 SMARD CARD READER
Digital HD receiver with full options, CARD READER and Common Interface, HDMI
 
Features:
 • MPEG-2 & MPEG-4 Fully DVB compliant
 • 4000 programmable channels
 • LNB Controlling Logic
 • Brilliant On Screen Graphic
 • Electronic Program Guide (EPG) for OSD Channel information
 • Auto search & Manual search function
 • User friendly OSD with Full Function
 • 4-digit 7-segment LED Display
 • HDMI;Component;2 Scarts;Composite Video
 • 256 Color Graphic User Interface
 • Favorite Channel and Parental Lock function
 • Software transfer by RS232 port
 • Teletext & Subtitle Supported (VBI & OSD)
 • Digital Tuner with Loop-through
 • Cover black
 • Included Cables: HDMI; Component Video; Composit Video, Audio
 
General Data:
  LED display: 4-Digits;7-Segments
  Input Voltage Rang e: 90~260V AC 50/60 Hz(SMPS)
  Power consumption: max 27 W
  Operating Temperature: 0°C ~40° C
  Size (WxDxH) in mm: 260x185x57
  Net-Weight: 1,5 kg
 
Video Decoder:
  Profile level: MPEG-2 MP@ML
  Video Resolution: 576i, 576p, 720p, 1080i
  Aspect Ratio: 4:3, 16:9, 4:3(Letter Box)
 
Audio Decoder:
  MPEG/ layer I & II,
  Sampling rate: 32,44.1 & 48KHz
  Audio modes: Mono/Dual Mono/Joint Stereo/Stereo
 
Connectors:
  SAT IN
  SAT OUT
  HDMI
  2 SCART TV (RGB, CVBS)/ VCR(RGB, CVBS)
  RCA/Composite Video(CVBS)(YPbPr)/Audio Left & Audio Right
  S/PDIF(Optical)
  RS232: RS232 D-sub male type serial port
 
Tuner:
  Input Frequency Range: 950~2150 MHz
  RF Input Level:-25~-65 dBm
  LNB Power: 13/18 V DC (+(- 5%) overload protected
  Max. 500 mA,
 
Demodulation:
  Modulation: QPSK,QAM256,VSB;64QAM
  Input Symbol Rate: 1~45 Msps/SCPC,MCPC
 
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept