Curs valutar


1 EURO = 4.7786 RON  
1 USD = 4.3095 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


 » Receptoare de satelit digitale High Definition

Amiko A5 combo

Receptor combo DVB-S2, DVB-C/T2 digital 4K

Amiko - Amiko A5 Combo

- Procesor Quadcore A53 la 1.5 GHz 64bit CPU
- Nucleu video pentacore Mali-MP450
- HEVC Main10 H.265 2160p60
- Suport video HEVC si VP9
- Suport audio DTS si DD
- Chipset AML S-905D 1.5 GHz
- 2 Gb RAM DDR3
- 16 Gb flash EMMC
- Tuner Combo DVB-S2 / DVB-T2 / DVB-C
- Port ethernet Gigabit 1Gbit
- Wi-Fi dual band 2.4 / 5 GHz
- Cardreader Conax
- SD card ( up to 32 Gb )
- USB 2.0
- Android 7.1.2 / dualboot Enigma2
- Enigma2 OpenATV 6.2 ( SD card )
- DTV LinkDroid
- Kodi 17.6
- YouTube 4K
- NetFlix 4K

Alte imagini:
Amiko A5 comboAmiko A5 comboAmiko A5 combo

Pret vechi fara TVA :
533,54 RON

Pret nou fara TVA :
453,20 RON

Pret nou cu TVA :
539,31 RON

Disponibilitate :


  • Compact Design
  • One S2 satellite & one T2 terrestrial / cable hybrid tuner
  • One card reader
  • Fast & easy installation
  • 64bit Quad Core 2.0GHZ Processor
  • 16GB integrated flash memory
  • 2 USB2.0 connections
  • Micro SD card expansion slot
  • Google Play™
  • YouTube videos
  • Based on Android™ 7.1
  • Hundreds of thousands of available applications!
  • KODI media player support
  • Easy streaming to iOS, Android™ devices & PC’s
  • DLNA - Easy playback over local network
  • 4K 2160p output via HDMI2.0
  • Ethernet connection & built in Wireless-N WiFi
  • Wired and wireless keyboard & mouse support
  • High quality digital surround sound via S/PDIF & HDMI
  • Low power consumption in Stand-By mode



System Resources

Main CPU: 64bit Quad Core

2.0GHZ Processor

Main GPU: Octo-core Mali 450MP GPU




Tuner & Demodulation

Tuner Type: DVB-S / DVB-S2

Input Connector: F-Type (Female)

Signal Level: -65 to -25 dBm

LNB Power: Vertical: +13V/14V,

Horizontal: +18V/19V

LNB Current: 400mA max (overload protection)

22kHz Tone: Frequency: 22 kHz ±4kHz

DiSEqC Control: Version 1.0, 1.1, 1.2, USALS

(Amplitude: 0.6 ±0.2V)

Demodulation: QPSK, 8PSK

Input Symbol Rate: 2-45Mbps, Convolution Code


FEC: 1/2, 2/3, 3/4, 5/6, 7/8, 1/4, 1/3,

2/5, 3/5, 4/5, 8/9, 9/10, auto

Tuner Type: DVB-T2 / DVB-T/ DVB-C

Frequency Range: 48~862MHz

RF Input Level: -80dBm to -20dBm

Antenna power output: DC 5V at max 75mA, Overload


Demodulation: COFDM 1K, 2K, 4K, 8K, 16K,

32K normal and extended

Input Symbol Rate: 1.0 ~ 7.0Ms/s

Constellations: QPSK, 16QAM, 64QAM,

256QAM / Both rotated and


Guard Intervals: 1/4, 19/256, 1/8, 19/128, 1/16,

1/32, 1/128

Code Rate: 1/2, 3/5, 2/3, 3/4, 5/6

Audio / Video Decoding

Input Rate: Max. 120Mbit/s

Aspect Ratio: 4:3, 16:9

Video Decoding: H.265/HEVC, MPEG-2, MP@ML,

MPEG-4 Part 10 / H.264

Video Resolution: 720*480p/i, 720*576p/i,

1280*720p, 1920*1080i/p, 2160p

Audio Decoding: MPEG-1 layer I/II, Mpeg2 layer II,

Dolby Digital

Audio Mode: Left / Right / Stereo / Mono

Sampling Rate: 32, 44.1 & 48KHz


HDMI: Type-A, Version 2.0

AV: Jack Type (CVBS video & Audio

L/R output)

USB: 2x High Speed USB2.0 ports

SD Card: 1 MicroSD card slot (up to 32GB)

Ethernet: 100/1000M RJ45

WiFi: 2.4G single band wifi

S/PDIF: Optical for digital audio output

Power Supply:

Type: External power supply

Input voltage: 110V - 240V AC

Output voltage: DC 12V (2A)

Stand-By power consumption: <0.5W

Physical Specifications:

Size (WxDxH): 140mm x 100mm x 31mm

Operation Temperature: 0ºC - 40ºC

Storage Temperature: -10ºC - 70ºC

Storage Humidity: 5-95% RH (Non Condensing)


Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept