Curs valutar


1 EURO = 4.7305 RON  
1 USD = 4.2682 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc


 » Receptoare de satelit digitale High Definition


Receptor combo DVB-S2, DVB-C/T2 digital 4K


  • One S2 satellite & one T2 terrestrial / cable hybrid tuner
  • One card reader
  • Fast & easy installation
  • 64bit Quad Core 2.0GHz processor
  • 8GB integrated flash memory
  • 2 USB2.0 connections
  • Micro SD card expansion slot
  • Google Play™
  • YouTube videos
  • Based on Android™
  • Hundreds of thousands of available applications!
  • KODI media player support
  • Easy streaming to iOS, Android™ devices & PC’s
  • DLNA - Easy playback over local network
Alte imagini:

Pret vechi fara TVA :
410,00 RON

Pret nou fara TVA :
351,00 RON

Pret nou cu TVA :
417,69 RON

Disponibilitate :


System Resources
Main CPU: AMlogic S905 quad core Cortex A53 64bit 2.0GHz
Main GPU: Octo-core Mali 450MP GPU (600MHz)
Flash Memory: 8GB

Tuner & Demodulation
Tuner Type: DVB-S / DVB-S2
Input Connector: F-Type (Female)
Signal Level: -65 to -25 dBm
LNB Power: Vertical: +13V/14V, Horizontal: +18V/19V
LNB Current: 400mA max (overload protection)
22kHz Tone: Frequency: 22 kHz ±4kHz
DiSEqC Control: Version 1.0, 1.1, 1.2, USALS (Amplitude: 0.6 ±0.2V)
Demodulation: QPSK, 8PSK
Input Symbol Rate: 2-45Mbps, Convolution Code Rate
FEC: 1/2, 2/3, 3/4, 5/6, 7/8, 1/4, 1/3, 2/5, 3/5, 4/5, 8/9, 9/10, auto

Tuner Type: DVB-T2 / DVB-T/ DVB-C
Frequency Range: 48~862MHz
RF Input Level: -80dBm to -20dBm
Antenna power output: DC 5V at max 75mA, Overload protection
Demodulation: COFDM 1K, 2K, 4K, 8K, 16K, 32K normal and extended
Input Symbol Rate: 1.0 ~ 7.0Ms/s
Constellations: QPSK, 16QAM, 64QAM, 256QAM / Both rotated and non-rotated
Guard Intervals: 1/4, 19/256, 1/8, 19/128, 1/16, 1/32, 1/128
Code Rate: 1/2, 3/5, 2/3, 3/4, 5/6
Audio / Video Decoding
Input Rate: Max. 120Mbit/s
Aspect Ratio: 4:3, 16:9
Video Decoding:H.265/HEVC, MPEG-2, MP@ML, MPEG-4 Part 10 / H.264
Video Resolution: 720*480p/i, 720*576p/i, 1280*720p, 1920*1080i/p, 2160p
Audio Decoding: MPEG-1 layer I/II, Mpeg2 layer II, Dolby Digital
Audio Mode: Left / Right / Stereo / Mono
Sampling Rate: 32, 44.1 & 48KHz

HDMI: Type-A, Version 2.0
AV: Jack Type (CVBS video & Audio L/R output)
USB: 2x High Speed USB2.0 ports
SD Card: 1 MicroSD card slot (up to 32GB)
Ethernet: 10/100M RJ45
WiFi: Built-in 802.11b/g/n WiFi connection
S/PDIF: Optical for digital audio output

Power Supply:
Type: External power supply
Input voltage: 110V - 240V AC
Output voltage: DC 12V (2A)
Stand-By power consumption: <0.5W

Physical Specifications:
Size (WxDxH): 140mm x 100mm x 31mm
Operation Temperature: 0ºC - 40ºC
Storage Temperature: -10ºC - 70ºC
Storage Humidity: 5-95% RH (Non Condensing)
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept