Curs valutar


1 EURO = 4.8314 RON  
1 USD = 4.4445 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9


 » Receptoare de satelit digitale High Definition

Receptor Terestrial Amiko T60 T2

Receptor Terestrial Amiko T60 T2

Amiko - Amiko T60

One High Speed USB 2.0 Connection

Full HD (1080p) Output via HDMI

Channel Recording to External Storage Devices

Timeshift support

Channel Recording & Timeshifting Simulteniously (optional)

True-color, User Friendly On-Screen Display (OSD)

Full Picture In Graphic (PIG) function

Electronic Program Guide (EPG) for on screen channel information

Subtitle supported

Alte imagini:
Receptor Terestrial Amiko T60 T2Receptor Terestrial Amiko T60 T2
Pret fara TVA:
78.40 RON

Pret cu TVA :
93,30 RON

Disponibilitate :


Teletext supported by VBI insertion and software emulation

Parental lock facility by channel and program event

Program and Channel information transfer from receiver to receiver

Exciting games embedded

Multi-Language support

Power Consumption in Stand-By: <0.5W

Tuner Type: DVB-T2

Frequency Range: 108~862MHz

RF Input Level: -80dBm to -20dBm

Antenna power output: DC 5V at max 75mA, Overload protection

Demodulation: COFDM 1K, 2K, 4K, 8K normal and extended, 16K normal and extended, 32K normal and extended

Input Symbol Rate: 1.0 ~ 7.0Ms/s

Constellations: QPSK, 16QAM, 64QAM

Guard Intervals: 1/4, 19/256, 1/8, 19/128, 1/16, 1/32, 1/128

Code Rate: 1/2, 3/5, 2/3, 3/4, 5/6

System Resources

Main Processor: 594MHz

Flash Memory: 32MBits

DDR RAM: 512Mbits

MPEG TS A/V Decoding

Transport Stream: MPEG-2, H.264

Input Rate: Max.120Mbit/s

Aspect Radio: 4:3, 16:9, Letter Box

Video Decoding: MPEG-2, MP@ML, MPEG-4 part 10/H264

Video Resolution: 720*480P/I, 720*576P/I, 1280*720p, 1920*1080i, 1920*1080p

Audio Decoding: MPEG-1 layer I/II, MPEG-2 layer II, Dolby digital

Audio Mode: Left / Right / Stereo/ Mono

Sampling Rate: 32, 44.1 and 48KHz

Power Supply

Input Voltage: 5V DC

Power Consumption: 10W Max

Stand-By Power Consumption: <0.5W

A/V & Data Input/Output

SCART: CVBS Video out / Audio L/R out

USB: One USB 2.0 slot

HDMI: VER1.3, Type A

Physical Specifications

Size: 130mm*30mm*65mm

Net Weight: 0.10KG

Operation Temperature: 0°C~+45°C

Storage Temperature: -10°C~+70°C

Storage Humidity: 5%~95% RH (Non-Condensing)

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept