Curs valutar

22-Apr-2019

1 EURO = 4.7607 RON  
1 USD = 4.2327 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality

ANPC

 » HD Media Players / MP3 players / MP4 players



ML7200

Receptor Satelit DVB S2 + IPTV STALKER H.265 HEVC

Medialink - ML7200

Receptor Satelit DVB S2 + IPTV CLIENT STALKER & XTREAM, H.265 HEVC, S2 HEVC, usor de utilizat, prietenos, economic, suporta toate sistemele IPTV,  S-IPTV, X-IPTV, Free IPTV, M3U, VOD, aplicatii media YouTube, SAMBA, MediaPlayer, Jocuri, Vremea, GoogleMap, Canale Adulti.

Pret: 266.60 RON
*) Pretul nu contine TVA
Disponibilitate :
Sunati

Optional, stick WiFi USB compatibil AICI

 

Actualizare firmware AICI

 

 

MAIN CHIPSET
CPU  High-Performance 667MHz 32-bit MIPS 24KEc 
MEMORY  
FLASH MEMORY  128Mb 
DDR3 SDRAM   2Gb RAM 
VIDEO DECODER 
TRANSPORT STREAM  MPEG-2 ISO/IEC 13818-2 
  MPEG-4 Part 2 
PROFILE LEVEL  MPEG-2 MP@ML, MPEG-2 MP@HL 
  MPEG-4 AVC/H.265 HP@L4.1
VIDEO FORMAT  4:3, 16:9, Letter Box 
VIDEO RESOLUTION  1080p, 1080i, 720p, 576p, 576i, 480p, 480i 
AUDIO/VIDEO/DATA INPUT/OUTPUT 
SCART OUTPUT Scart
RS-232C  Phone Jack Type (Max.115200bps)
HD Out 1 x HD Out
USB  2 x (USB 2.0 Host), Front & Rear  
ETHERNET and USB-WiFi    RJ-45 Ethernet and USB WiFi support 
AUDIO DECODING 

MPEG/MusiCam Layer I & II, AC3 Down Mix

AUDIO MODE Mono/Dual/Joint Stereo/Stereo
AUDIO BIT RATE 32Kbits/s-384Kbits/s
SAMPLING FREQUENCY 32, 44.1, 48 KHz
 POWER SUPPLY 
INPUT VOLTAGE  DC 12V 2A 
TYPE  Adapter Type 
PROTECTION  Separate internal fuse, the input should be protected against lighting
PHYSICAL CHARACTERISTICS 
DIMENSION (W x H x D)  220 x 40 x 120 (mm) 
NET WEIGHT  Approx. 1.0Kg 
OPERATING TEMPERATURE  0℃ to +45℃ 
STORAGE TEMPERATURE  (-10℃ to +70℃

 

 

 

 

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept