Curs valutar


1 EURO = 4.7305 RON  
1 USD = 4.2682 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc


 » Receptoare de satelit digitale High Definition

Amiko Mira

Receptor Satelit Amiko Mira DVB-S2

Amiko - Amiko Mira

One Conax Embedded card reader

6000 channels (TV and Radio) programmable

External IR Sensor (Included in the package)

Mountable on TV (Sticker included in the package)

One High Speed USB 2.0 Connection

USB WiFi Support (Ralink RT5370 chip only)

YouTube videos (3rd party content, subject to availability)

RSS Reader & Weather Forecast Functions (WiFi connection required)

DiSEqC 1.0, 1.1, 1.2 and USALS Compatible

Full HD (1080p) Output via HDMI

Channel Recording to External Storage Devices

Alte imagini:
Amiko MiraAmiko MiraAmiko Mira

Pret vechi fara TVA :
150,00 RON

Pret nou fara TVA :
119,00 RON

Pret nou cu TVA :
141,61 RON

Disponibilitate :


Timeshift support

Channel Recording & Timeshifting Simulteniously (optional)

Channel switching time less than 1 second

True-color, User Friendly On-Screen Display (OSD)

Full Picture In Graphic (PIG) function

Electronic Program Guide (EPG) for on screen channel information

Subtitle supported

Teletext supported by VBI insertion and software emulation

Parental lock facility by channel and program event

Program and Channel information transfer from receiver to receiver

Multi-Language support

Power Consumption in Stand-By: <0.5W

Tuner & Demodulation

Tuner Type: DVB-S / DVB-S2

Input Connector: F-type, Connector, Female

Signal Level: -65 to -25 dBm

LNB Power & Polarization: Vertical: +13V/+14V,

Horizontal: +18V/+19V

Current: Max. 400mA

Overload Protection

22KHz Tone Frequency: 22±1KHz

DiSEqC Control: Version 1.0, 1.1, 1.2, USALS

Demodulation: QPSK, 8PSK

Input Symbol Rate: 2-45 Mbps,

FEC: 1/2, 2/3, 3/4, 5/6, 7/8 and Auto

System Resources

Main Processor: Dual Core 494MHz / 337MHz

Flash Memory: 64MBits

DDR RAM: 1024Mbits

MPEG TS A/V Decoding

Transport Stream: MPEG-2, H.264

Input Rate: Max.120Mbit/s

Aspect Radio: 4:3, 16:9, Letter Box

Video Decoding: MPEG-2, MP@ML, MPEG-4 part 10/H264

Video Resolution: 720*480P/I, 720*576P/I, 1280*720p, 1920*1080i, 1920*1080p

Audio Decoding: MPEG-1 layer I/II, MPEG-2 layer II, Dolby digital

Audio Mode: Left / Right / Stereo/ Mono

Sampling Rate: 32, 44.1 and 48KHz

Power Supply

Input Voltage: 12V DC

Power Consumption: 18W Max

Stand-By Power Consumption: <0.5W

A/V & Data Input/Output

SCART: CVBS Video out / Audio L/R out

USB: One USB 2.0 slot

S/PDIF: Coaxial

HDMI: VER1.4, Type A

IR Port: Internal & Jack Type

Physical Specifications

Size: 144mm*40mm*110mm

Net Weight: 0.25KG

Operation Temperature: 0°C~+45°C

Storage Temperature: -10°C~+70°C

Storage Humidity: 5%~95% RH (Non-Condensing)

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept