Curs valutar

16-Sep-2019

1 EURO = 4.7354 RON  
1 USD = 4.2654 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

 » Receptoare optice fara cale inversa de interior FTTH, FTTB



MW-HOME PIN

Receptor Optic pt scara bloc ( >12 apart), 2 iesiri RF putere hybrid ( >100dBuV), reglaj EQ & ATT, TS684, power meter,

Braun_Group - MW-HOME PIN

Receptor optic DIODA PIN - HOME, SC/APC, 2 ies RFx100dBuV ,  aliementare 180-220V, reglaj tilt si atenuare pt compensarea semnal pe coaxial 862Mhz, ...optical power meter cu LED pentru intrarea optica,  
intrare optica banda larga pentru laseri 1310nm ...1550nm 
Semnalul este amplificat cu hybrid permitind conectarea unui numar mare de consumatori.
optical receiver, 2-port output, E-O pin diode, amplifier hybrid, 45-862MHz, variable ATT and EQ (15dB),  F type female port,  SC/APC connector,  output level 100dBuV (input optical power -2dBm),  
 

Alte imagini:
MW-HOME PINMW-HOME PINMW-HOME PIN





Pret vechi fara TVA :
189,42 RON


Pret nou fara TVA :
151,53 RON

Pret nou cu TVA :
180,32 RON

Disponibilitate :
Sunati

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept