Curs valutar

03-Jun-2020

1 EURO = 4.8419 RON  
1 USD = 4.3293 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin

ANPC

 » Receptoare optice fara cale inversa, etanse pentru montare exterioara



Receptor Optic de exterior NextraCOM NX-8602MC

Receptor Optic de exterior

nextraCOM - NX-8602MC

Receptor optic etans de exterior,  DIODA PIN -7+2dB, 1100-1600nm, conector SC/APC, 2 ies RFx102dBuV (1 hibrid RF)

Alte imagini:
Receptor Optic de exterior NextraCOM NX-8602MC
Pret fara TVA:
256.84 RON

Pret cu TVA :
305,64 RON

Disponibilitate :
Sunati

NextraCOM NX-8602MC Outdoor optical receiver,  DIODA PIN

Optical receiver is our new development product that is especially used in CATV networks. The pre-amp adopts GaAs MMIC amplify module (the series have two kinds of model, one is M model that the RF attenuation and equilibrium design adopts succesive adjustability, the other is MF model which adopts unadjustable insert. or as per customer, adopts other module). With optimization design and plentiful technical experience that made this equipment with high performance specification. It is a ideal model for CATV network.

Performance Characteristics

  • High responsible, with PIN photoelectric converter
  • High precision, with 10 cascade LED display the optical power
  • Optimization and typical circuit design, the pre adopts SMT process and the post adopts module amplify that made the photoelectronic signal transmission fluency
  • Power doubler output, high gain and low distortion
  • With AGC, when the input optical power range is -7~+2dBm, the output level, CTB and CSO are keep constantly
SPECIFICATIONS
Item Unit Parameter
Optical Parameter
Receive optical Power dBm -7 ~ +2
Optical return loss dB >45
Optical receive wavelength
nm 1100 ~ 1600
Optical Connector Type   FC/APC , SC/APC or name by consumer
Optical Fiber Type   Single
Optical Link Performance
C/N dB ≥ 51 (when the input : -2dBm)
C/CTB dB ≥ 65
C/CSO dB ≥ 60
RF Parameter
Frequency Range MHz 45 ~ 862
Flatness Band dB ± 0.75
Standard Output Level dBµV ≥  105
(-7~2dBm)
≥  108
(-7~2dBm) 
≥  105
(-7~2dBm) 
≥  108
(-7~2dBm) 
Max Output Level dBµV  ≥  105 ≥  114 ≥  105 ≥  114
Output Return Loss dB ≥  14
Output Impedance Ω 75
Adjustable Equalizer Range dB 0 ~ 15
Adjustable Attenuator Range dB 0 ~ 15
General Performance
Power Voltage V AC (130 ~ 265)V or AC (35 ~ 85)V
Operating Temperature °C -40~60
Storage Temperature °C -40~60
Relative Humidity % Max 95% No Condesation
Compsumption VA ≤ 15
Dimensions mm 185 (L) x 140 (W) x 91 (H)
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept