Curs valutar


1 EURO = 4.7354 RON  
1 USD = 4.2654 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Receptoare optice fara cale inversa, etanse pentru montare exterioara

Receptor Optic de exterior Maiwei MW-ONU-41

Receptor Optic de exterior

Braun_Group - MW-ONU-41

Receptor optic etans de exterior, -7+2dB, 1100-1600nm, conector SC/APC, 2 ies RFx102dBuV (1 hibrid RF), alimentare 220V sau 60V, dimensiuni : 250x140x100mm

Alte imagini:
Receptor Optic de exterior Maiwei MW-ONU-41Receptor Optic de exterior Maiwei MW-ONU-41Receptor Optic de exterior Maiwei MW-ONU-41Receptor Optic de exterior Maiwei MW-ONU-41
Receptor Optic de exterior Maiwei MW-ONU-41Receptor Optic de exterior Maiwei MW-ONU-41Receptor Optic de exterior Maiwei MW-ONU-41Receptor Optic de exterior Maiwei MW-ONU-41Receptor Optic de exterior Maiwei MW-ONU-41

Pret vechi fara TVA :
236,77 RON

Pret nou fara TVA :
213,09 RON

Pret nou cu TVA :
253,58 RON

Disponibilitate :

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept