Curs valutar


1 EURO = 4.7786 RON  
1 USD = 4.3095 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


 » Receptoare de satelit digitale High Definition


Receptor DVB-S2 PVR + IPTV STALKER & VOD Multimedia

Medialink - ML1100S+LAN, IPTV STALKER

Cel mai versatil Receptor de satelit FTA-HD Medi@Link High Definition cu adaptor USB la RJ45 LAN inclus in pret.
BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player, INTERNET RADIO, SAMBA, PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p

Alte imagini:

Pret nou fara TVA :
132,87 RON

Pret nou cu TVA :
158,12 RON

Disponibilitate :

Include Adaptor USB la RJ45 LAN


Actualizare firmware AICI


Hardware Specification
CPU High-Performance 667MHz 32-bit MIPS 24KEc




FEC MODE DVB-S: Auto, 1/2, 2/3, 3/4, 5/6, 7/8


- QPSK: Auto, 1/2, 3/5, 2/3, 4/5, 5/6, 8/9, 9/10

- 8PSK: Auto, 3/5, 2/3, 3/4, 5/6, 8/9, 9/10

CONNECTOR 75Ω Unbalanced
Vertical: +13.5V (+14.5V at high voltage)
Horizontal: +18V (+18.5V at high voltage)
Current: Max. 500mA (Short Circuit Protection)
22KHz TONE Frequency 22KHz±4KHZ
Amplitude 0.6±0.2Vpp
DiSEqC CONTROL 1.0, 1.1 & 1.2 Version Compliant
CHANNEL SELECTION PLL Frequency Synthesizer

MPEG-4 Part 2
MPEG-4 AVC/H.264 HP@L4.1
VIDEO FORMAT 4:3, 16:9, Letter Box
VIDEO RESOLUTION 1080p, 1080i, 720p, 576p, 576i, 480p, 480i

AUDIO DECODING MPEG/MusiCam Layer I & II, AC3 Down Mix
AUDIO MODE Mono / Dual / Joint Stereo / Stereo
AUDIO BIT RATE 32Kbits/s – 384Kbits/s

RS-232C 9 Pin D-Sub Socket Type (Max.115200bps)
HDMI 1 x HDMI 1.3
USB 2 x (USB 2.0 Host), Front & Rear

Wifi USB Adapter

INPUT VOLTAGE AC 90~250V, 50/60Hz
TYPE SMPS (Switching Mode Power Supply)
PROTECTION Separate internal fuse
The input should be protected against lighting.

DIMENSION (W x H x D) 220 x 40 x135 (mm) 
NET WEIGHT Approx. 1.1 Kg

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept