Curs valutar


1 EURO = 4.7627 RON  
1 USD = 4.3164 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvcltecasetacyberpower


 » Receptoare de satelit digitale High Definition


Receptor Combo Amiko HD8265+ DVB-S2 + DVB-C + DVB-T2

Amiko - Amiko HD8265+

One Conax Embedded card reader

One Common Interface slot

HEVC decoding support

6000 channels (TV and Radio) programmable

Two High Speed USB 2.0 Connections

Ethernet Connection & USB WiFi Support (Ralink RT5370 chip only)

YouTube videos (feature subject to availability)

RSS Reader & Weather Forecast Function

Channel Recording to External Storage Devices (optional)

Timeshift support

Alte imagini:

Pret vechi fara TVA :
227,00 RON

Pret nou fara TVA :
213,00 RON

Pret nou cu TVA :
253,47 RON

Disponibilitate :


Tuner & Demodulation

Tuner Type: DVB-S / DVB-S2

Input Connector: F-type, Connector, Female

Signal Level: -65 to -25 dBm

LNB Power & Polarization: Vertical: +13V/+14V, Horizontal: +18V/+19V

Current: Max. 400mA (Overload Protection)

22KHz Tone Frequency: 22±1KHz

DiSEqC Control: Version 1.0, 1.1, 1.2, USALS

Demodulation: QPSK, 8PSK

Input Symbol Rate: 2-45 Mbps,

FEC: 1/2, 2/3, 3/4, 5/6, 7/8 and Auto

Tuner Type: DVB-T2 / DVB-C

Frequency Range: 48~862MHz

RF Input Level: -80dBm to -20dBm

Antenna power output: DC 5V at max 75mA, Overload protection

Demodulation: COFDM 1K, 2K, 4K, 8K normal and extended, 16K normal and extended, 32K normal and extended

Input Symbol Rate: 1.0 ~ 7.0Ms/s

Constellations: QPSK, 16QAM, 64QAM, 256QAM / Both rotated and non-rotated

Guard Intervals: 1/4, 19/256, 1/8, 19/128, 1/16, 1/32, 1/128

Code Rate: 1/2, 3/5, 2/3, 3/4, 5/6

MPEG TS A/V Decoding

Transport Stream: MPEG-2, H.264, H.265

Input Rate: Max.120Mbit/s

Aspect Radio: 4:3, 16:9, Letter Box

Video Decoding: MPEG-4/H.265 SP@L3 to ASP@L5, AVC, HP@level 4.1, MP@level 4.1

Video Resolution: 720*480P/I, 720*576P/I, 1280*720p, 1920*1080i, 1920*1080p

Audio Decoding: MPEG-1/2,AAC-LC,HE-AAC,MP3,Dolby Digital

Audio Mode: Left / Right / Stereo/ Mono

Sampling Rate: 32, 44.1 and 48KHz System Resources

Main Processor: 800MHz CPU

Flash Memory: 16MB


Power Supply

Input Voltage: 12VDC

Power Consumption: 24W Max

Stand-By Power Consumption: <0.5W

A/V & Data Input/Output

RCA: Jack-type, CVBS Video out, L&R Audio out

RS-232C: Jack-type, Transfer rate 115.2Kbps, 9 pin D-sub Type

USB: Two USB 2.0 slots

S/PDIF: Optical

HDMI: VER1.4, Type A

Ethernet: 10/100M RJ45

IR IN: Jack-type, External IR sensor connection

Physical Specifications

Size: 180mm x 43mm x 155mm

Net Weight: 1.0KG

Operation Temperature: 0°C~+45°C

Storage Temperature: -10°C~+70°C

Storage Humidity: 5%~95% RH (Non-Condensing)

Channel Recording & Timeshifting Simulteniously (optional)

Channel switching time less than 1 second

True-color, User Friendly On-Screen Display (OSD)

Full Picture In Graphic (PIG) function

Electronic Program Guide (EPG)

Subtitle supported

Teletext supported with VBI insertion

Parental lock facility by channel and program event

Program and Channel information transfer from receiver to receiver

Satellite Blind Scan & Fast Scansupport

DiSEqC 1.0, 1.1, 1.2 and USALS Compatible

Full HD (1080p) Output via HDMI

Exciting games embedded

Multi-Language support

Software upgrade support via USB, Network, OTA, RS232

Power Consumption in Stand-By: <0.5W

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept