Curs valutar

28-Feb-2020

1 EURO = 4.8068 RON  
1 USD = 4.3926 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9

ANPC

 » PDA cu GPS, antena GPS externa, receptor GPS Bluetooth, accesorii GPS



Receptor Bluetooth GPS West Studio BT-74R

Receptor Bluetooth GPS

West Studio - BT-74R

Receptor GPS Bluetooth, chipset Fujitsu, 32 Ch., -157 dBm, Acumulator Li-Ion 1100 mA, operare 13H

Pret fara TVA:
241.11 RON

Pret cu TVA :
286,93 RON

Disponibilitate :
Sunati

BT74R - GPS Bluetooth Receiver
 
Description:
BT74R Bluetooth GPS receiver, a total solution of GPS Bluetooth wireless technology, acquires 32 satellites, provides unbelievable positioning sensitivity and transmitting ability to an easy position-fix from urban or canyon area.

BT74R allows from 13 hours continuous use to stand-by time up to one week with a single battery (1100mA/h) charge.
Specifications:
Chipset RFMD-Fujitsu
Channel 32
Tracking Sensitivity -157dBm
Cold Start 43 sec.
Warm start 25 sec.
Hot Start 4 sec.
Battery Rechargeable Li-ion battery
Battery capacity 1100mA/h
Operation hours 13
Charging hours 3 (typical)
Bluetooth verion V1.2
Buetooth profile Serial port profile
Buetooth power Class Class 2 (10m)
Dimensions (LxWxH mm) 81x43x17.6
Weight (battery included) 70g
Certificate CE, FCC, BQB, ROHS
 
 
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept