Curs valutar

28-Feb-2020

1 EURO = 4.8068 RON  
1 USD = 4.3926 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9

ANPC

 » PDA cu GPS, antena GPS externa, receptor GPS Bluetooth, accesorii GPS



Receptor Bluetooth GPS West Studio BT-55

Receptor Bluetooth GPS

West Studio - BT-55

Receptor GPS Bluetooth, chipset Nemerix, 16 Ch., -152 dBm, Acumulator Li-Ion 710 mA, operare 22H

Pret fara TVA:
200.52 RON

Pret cu TVA :
238,61 RON

Disponibilitate :
Sunati

BT55 - GPS Bluetooth Receiver
 
Description:
 The GPS-BT55 GPS Receiver with Bluetooth combines proven wireless technologies that allows you to receive positioning data and connect to mobile computing devices wirelessly. The GPS-BT55 provides high position accuracy and has reliable tracking capabilities. The ultra low power design gives you up to 20 hours of continuous usage and eliminates constant recharging between uses.

 With optional waterproof case, you can put it on the roof of a vehicle that boosts your reception capabilities when driving through congested urban.

 It's easy to connect the GPS receiver to your mobile devices, such as pocket PCs, PDAs and mobile phones using Bluetooth wireless connectivity. A few simple steps will have you connected and navigating in minutes.
 
Features:
 • 16 channels "All-In-View" tracking
 • Cold/Warm/Hot start time: 45/38/6 sec. (average)
 • Superior sensitivity: -152dBm tracking
 • Reacquisition time: 1 sec.
 • Build-in ceramic patch antenna
 • Build-in rechargeable Li-ion battery
 • Support standard NMEA-0183 at 38400 bps baud rate
 • Compatible with Bluetooth devices with Serial Port Profile (SPP)
 • Ultra low power consumption: up to 22 hours continuous use by using 710mAh battery
 • Time to full recharge: 3 hours
 • 2 LEDS display GPS and Bluetooth status
 • Size: 61.5 (L) X 43.5 (W) X 20.5 (H) mm
 • Weight: 51.4g (battery included)
 • Non-slip back pad for a secure placement
 
Specifications:
GPS Features
Chipset Nemerix
Frequency L1, 1575.42MHz
C/A Code 1.023MHz chip rate
Channels 16 channels "all-in-view" tracking
Antenna (Internal) Built-in low noise antenna
External MMCX antenna port
Sensitivity
To 152dBm Tracking, Superior Urban Canyon Performance
Time to First Fix (TTFF)
Cold Start 45 sec, average
Warm Start 38 sec, average
Hot Start 6 sec, average
Reacquisition 1 sec
Update rate 1 Hz (max.)
Accuracy
Position 5m CEP (50%), 9m (90%)
Velocity 0.1m/sec, without SA
Time ±100ns synchronized to GPS time
Power
Built-in rechargeable 710mAh Li-ion battery and 5V DC input
Operation Current 33mA (Typical)
Operation Time 22hrs, fully charged, in continuous mode
Charging time 3.0hrs. (Typical)
Datum
WGS-84
Dynamic Conditions
Altitude 10,000m Max.
Velocity Hor.300km/hour; Ver.36km/hour Max.
Acceleration 2g Max.
Motional Jerk 4m/sec
Interface
Communication Protocol Communicate with host platform via Bluetooth (class 2) serial port profile
Bluetooth communication distance 10meters (Typical)
GPS Protocol Default: NMEA-0183 V3.01 - GGA(1), GSA(3), GSV(3), RMC(1),VTG(1), baud rate 38400 bps
Data bit 8, stop bit, 1 (Default)*
Device Size and Weight
61.5 (L) X 43.5 (W) X 20.5 (H) mm
51.4g (battery included)
Accessories
Car charger (12V in, 5V output)
AC adaptor (5.3V output, 500mA)
Environmental Characteristics
Operating Temperature - 10°C to + 60°C
Storage Temperature - 20°C to + 85°C
Certificate CE, FCC, BQB, ROHS
 
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept