Curs valutar

20-Sep-2019

1 EURO = 4.7415 RON  
1 USD = 4.2846 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

 » Receptoare de satelit digitale High Definition



ML-4100T2C

Receptor 3in1 PVR HD DVB-C2 & DVB-T2 & IPTV STALKER

Medialink - ML4100TC

Cel mai versatil Receptor de Cablu DVB-C2 (compatibil UPC si DIGI, ... transmise in clar) si cu ultimul standard  de transmisie Terestradigitala  DVB-T2 Medi@Link High Definition FTA cu modul usb -PVR, BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player, INTERNET RADIO conexiune ethernet 10/100 SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p.
Placa ethenet este integrata pe placa de baza.

Canalul oficial de prezentare MEDIALINK de pe youtube, cu clipurile oficiale de prezentare: https://www.youtube.com/channel/UCn3eMQFyC_TocZxTiC0HoRA

Alte imagini:
ML-4100T2CML-4100T2CML-4100T2C





Pret vechi fara TVA :
230,00 RON


Pret nou fara TVA :
175,00 RON

Pret nou cu TVA :
208,25 RON

Disponibilitate :
Sunati

Optional, stick WiFi USB compatibil AICI

 

Actualizare firmware AICI

 

Hardware Specification

MAIN CHIPSET
CPU High-Performance 667MHz 32-bit MIPS 24KEc

MEMORY
FLASH 128MB
DDR3 SDRAM 2GB

DVB -T2

Input Connector IEC 169 - 2, Female

Frequency Range 147 ~ 230 MHz, 470 ~ 862 MHz

Signal Level Input -80 ~ -20dBm

Aerial Supply 5V, max. 100mA

Demodulation QAM

Carrier Mode 1K, 2K, 4K, 8K, 16K, 32K

Constellation 16 and 64QAM

Guard Interval 1/4, 1/8, 1/16 and 1/32

Input Connector IEC 169 - 2, Female

DVB -C

Input Connector F-type, IEC 169-24, Female

Frequency Range 51 ~ 858 MHz

Symbol Rates 0.87m ~ 9M baud

Sensitivity -47dBm (64 QAM ~ 256 QAM)

VIDEO DECODER
TRANSPORT STREAM MPEG-2 ISO/IEC 13818-2
MPEG-4 Part 2
PROFILE LEVEL MPEG-2 MP@ML, MPEG-2 MP@HL
MPEG-4 AVC/H.264 HP@L4.1
VIDEO FORMAT 4:3, 16:9, Letter Box
VIDEO RESOLUTION 1080p, 1080i, 720p, 576p, 576i, 480p, 480i

AUDIO DECODER
AUDIO DECODING MPEG/MusiCam Layer I & II, AC3 Down Mix
AUDIO MODE Mono / Dual / Joint Stereo / Stereo
AUDIO BIT RATE 32Kbits/s – 384Kbits/s
SAMPLING FREQUENCY 32, 44.1, 48KHz

AUDIO / VIDEO / DATA INPUT/OUTPUT
VIDEO OUTPUT 1 x RCA Cinch
AUDIO OUTPUT 2 x RCA Cinch (L/R)
DIGITAL AUDIO OUTPUT 1 x S/PDIF (RCA)
RS-232C 9 Pin D-Sub Socket Type (Max.115200bps)
HDMI 1 x HDMI 1.3
USB 2 x (USB 2.0 Host), Front & Rear

POWER SUPPLY
INPUT VOLTAGE AC 90~250V, 50/60Hz
TYPE SMPS (Switching Mode Power Supply)
PROTECTION Separate internal fuse
The input should be protected against lighting.

PHYSICAL CHARACTERISTICS
DIMENSION (W x H x D) 220 x 40 x120 (mm) 
NET WEIGHT Approx. 1.0 Kg
OPERATING TEMPERATURE 0℃ to +45℃
STORAGE TEMPERATURE -10℃ to +70℃

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept