Curs valutar

17-Jun-2019

1 EURO = 4.7228 RON  
1 USD = 4.1899 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200

ANPC


Receptoare radio

 
  Descriere Pret
Receptor Radio INTEK PL-660Receptor Radio INTEK - PL-660

Receptor Radio, +VHF AIR BAND + MW,
MODES : AM-FM / NARROW-WIDE BANDWIDTH
SW 1.7-30.0 MHz
FM 88-108 MHz
MW 520-1710 KHz

Pret : 562.01 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept