Curs valutar


1 EURO = 4.7581 RON  
1 USD = 4.2268 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality


Receptoare optice fara cale inversa de interior FTTH, FTTB

  Descriere Pret
OR27-WDMMinireceptor optic FTTH cu WDM nextraCOM - OR27-WDM

Minireceptor optic FTTH de interior cu filtru WDM pe intrare, pentru retele GPON/GEPON, intrare CATV (1550nm)+PON(1310/1490nm) pe conector SC/APC, iesire PON WDM Ethernet 1310/1490nm pe conector SC/PC, nivel optic intrare -18+2dBm, cu AGC optic in plaja –12-2dBm, nivel iesire RF TV=75dB in banda 47-1000MHZ, temperatura de lucru -25+65 grade Celsius, consum <1W, dimensiuni 90x65x25mm

Pret : 104.68 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
NX8601 J/L 220VReceptor optic FTTB cu WDM nextraCOM - NX8601 J/L 220V

Nod optic NEXTRA FTTB, cu AGC optic pe intrare, intrare optica cale directa 1100-1600nm, nivel intrare -9+2dBm, conector SC/APC, cale directa 2 iesiri RF x 104dBuV, 87-860MHz, control electronic ( fara semireglabili) pentru tilt 0-15dB si atenuare 0-15dB, cale inversa 5-65MHz, nivel intrare 75-85dBuV, emitator optic cale inversa FP 1mW, lungime de unda 1310nm, alimentare AC 150-265V, consum < 9W, temperatura operare -30+60 grade Celsius, dimensiuni 190x110x52mm.

Pret : 428.23 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
MW-FTTB-ORReceptor optic FTTB Braun Group - MW-FTTB-OR
Receptor optic Braun Group FTTB, intrare 1200-1600nm, nivel intrare -16+3dBm, conector SC/APC, 2 iesiri RF x 106dBuV, 47-862MHz, AGC optic in plaja -5+2dBm, control digital cu display pentru tilt si atenuare 0-20dB. Alimentare VDC 12V, consum <25W, dimensiuni 190x145x40mm.
Pret : 180.81 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
MW-FTTH-WDMReceptor optic FTTH Braun Group - MW-FTTH-WDM
Minireceptor optic FTTH de interior, intrare optica 1310/1490/1550nm, nivel optic –12+0dBm, conector optic intrare SC/APC, iesire PON 1310/1490nm, conector optic iesire PON SC/PC, banda RF la iesire 47-2600MHz, 2 iesiri RF pe mufa F, nivel iesire RF 80-95dB, reglare nivel RF iesire 0-20dB, alimentare 12VDC, dimensiuni 97x96x32mm
Pret : 104.68 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
NX-8682MFMinireceptor optic FTTH nextraCOM - NX-8682MF

Minireceptor optic FTTH de interior, intrare optica 1550nm+/-10nm (include filtru optic pe intrare), nivel optic –8+2dBm, AGC optic (MGC reglabil), conector optic SC/APC, banda RF la iesire 45-1000MHz, nivel iesire RF>82dB pt intrare -8+2dBm, atenuare pe iesire 0-20dB (valabil in modul MGC) temperatura de lucru -20+55 grade Celsius, consum <1,2W, dimensiuni 104x85x25mm

Pret : 81.84 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
NX1201Mini receptor optic pasiv nextraCOM - NX1201

Mini receptor optic pasiv FTTH, nu necesita sursa de alimentare, lungime de unda optica la intrare 1100-1600nm, nivel optic la intrare -18+0dBm, conector optic SC/APC, frecventa RF iesire 47-1218MHz, nivel RF iesire 65dBuV (pt nivel optic intrare 0dBm), temperatura operare -20+55 grade Celsius, dimensiuni 50x16x12mm (poate functiona in tandem cu amplificatorul Nextra LH1030/LH1026)

Pret : 16.18 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
MW-FTTH-MINI-1550Minireceptor optic FTTH Braun Group - MW-FTTH-MINI-1550

Minireceptor optic FTTH de interior, intrare optica 1550nm+/-10nm (filtru optic pe intrare), nivel optic –12+3dBm, conector optic SC/APC, banda RF la iesire 40-870MHz, nivel iesire RF 92dB(intr.optica –2dBm) 102dBuV (intr.optica +3dBm), reglare nivel RF iesire 0-18dB (MGC), temperatura de lucru -20+60 grade Celsius, umiditate 5-65%, alimentare 12VDC, consum <2W, dimensiuni 100x60x25mm

Pret vechi: 116.57 RON
Pret nou:
110.39 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
NX-1082MMinireceptor optic FTTH nextraCOM - NX-8682M

Minireceptor optic FTTH de interior, intrare optica 1100-1600nm, nivel optic –8+2dBm, AGC optic (MGC reglabil), conector optic SC/APC, banda RF la iesire 45-1000MHz, nivel iesire RF>82dB pt intrare -8+2dBm, atenuare pe iesire 0-20dB (valabil in modul MGC) temperatura de lucru -20+55 grade Celsius, consum <1,2W, dimensiuni 104x85x25mm

Pret : 77.08 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
OR1001J-WDReceptor optic FTTB cu WDM nextraCOM - NX8601J-WD

Receptor optic de interior cu filtru WDM pe intrare, intrare TV 1550nm -9+0dBm + trecere pentru Ethernet PON 1310/1490nm, conectori optici SC/APC, SC/PC, AGC optic, 2 iesiri RFx110dB, control electronic ( fara semireglabili) pentru tilt 0-15dB si atenuare 0-15dB, temperatura de lucru -40+60 grade Celsius, consum <8W, dimensiuni 190x110x50mm

Pret : 323.55 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
WR-8601LReceptor optic miniatura de interior DIODA PIN nextraCOM - WR-8601L

Receptor optic miniatura de interior DIODA PIN SC/APC, 1 iesire RF x 95dB, 45-860MHz, alim. 220V

Pret : 190.32 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
NX-8682AFMinireceptor optic FTTH nextraCOM - NX-8682AF

Minireceptor optic FTTH de interior, intrare optica 1550nm+/-10nm (include filtru optic pe intrare), nivel optic –8+2dBm, AGC optic (automat), conector optic SC/APC, banda RF la iesire 45-1000MHz, nivel iesire RF>82dB pt intrare -8+2dBm, temperatura de lucru -20+55 grade Celsius, consum <1,2W, dimensiuni 104x85x25mm

Pret vechi: 69.94 RON
Pret nou:
59.48 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MW-FTTH-MINIMinireceptor optic FTTH Braun Group - MW-FTTH-MINI

Minireceptor optic FTTH de interior, intrare optica 1210-1600nm, nivel optic –12+3dBm, conector optic SC/APC, banda RF la iesire 40-870MHz, nivel iesire RF 92dB(intr.optica –2dBm) 102dBuV (intr.optica +3dBm), reglare nivel RF iesire 0-18dB (MGC), temperatura de lucru -20+60 grade Celsius, umiditate 5-65%, alimentare 12VDC, consum <2W, dimensiuni 100x60x25mm  

Pret vechi: 78.51 RON
Pret nou:
76.13 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MW-HOME PINReceptor Optic pt scara bloc ( >12 apart), 2 iesiri RF putere hybrid ( >100dBuV), reglaj EQ & ATT, TS684, power meter, Braun_Group - MW-HOME PIN

Receptor optic DIODA PIN - HOME, SC/APC, 2 ies RFx100dBuV ,  aliementare 180-220V, reglaj tilt si atenuare pt compensarea semnal pe coaxial 862Mhz, ...optical power meter cu LED pentru intrarea optica,  
intrare optica banda larga pentru laseri 1310nm ...1550nm 
Semnalul este amplificat cu hybrid permitind conectarea unui numar mare de consumatori.
optical receiver, 2-port output, E-O pin diode, amplifier hybrid, 45-862MHz, variable ATT and EQ (15dB),  F type female port,  SC/APC connector,  output level 100dBuV (input optical power -2dBm),  

Pret vechi: 190.32 RON
Pret nou:
152.26 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
NX-1082AMinireceptor optic FTTH nextraCOM - NX-8682A

Minireceptor optic FTTH de interior, intrare optica 1100-1600nm, nivel optic –8+2dBm, AGC optic (automat), conector optic SC/APC, banda RF la iesire 45-1000MHz, nivel iesire RF>82dB pt intrare -8+2dBm, temperatura de lucru -20+55 grade Celsius, consum <1,2W, dimensiuni 104x85x25mm

Pret vechi: 65.19 RON
Pret nou:
54.72 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
2Minireceptor optic FTTH cu iesire GPON/GEPON echipat cu filtru WDM nextraCOM - OR1075MB-WD

Receptor special proiectat pentru arhitectura OLT gigabit GPON /GEPON pentru ethernet/ internet impreuna cu semnal CATV pe o singura fibra single mode (green SC/APC input).

Minireceptor optic FTTH de interior cu filtru WDM pe intrare, intrare TV 1550nm -10+0dBm + trecere pentru Ethernet PON 1310/1490nm, conectori optici SC/APC, SC/PC, iesire RF>78dB la intrare -6dBm, temperatura de lucru -20+55 grade Celsius, consum <3W, dimensiuni 109x80x26mm
intrarea de banda larga CATV +PON pe conector SC/APC verde;
semnal CATV electric 5-1000Mhz pe iesirea F-coax;
iesire SC/PC albastru filtrata WDM pentru conectarea unui terminal ONU/ONT gigabit 1310/1490nm
sau a filtru PLC pentru multipli clienti PON
Este compatibil 100% cu orice terminal Gigabit EPON sau gigabit GPON recunoscut de OLT-ul din head end

Pret : 104.68 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
OR-8601J/NCReceptor Optic FTTB-control electronic nextraCOM - NX8601J/NC

Receptor optic NEXTRA FTTB, intrare 1100-1600nm, nivel intrare -9+2dBm, conector SC/APC, 2 iesiri RF x 110dBuV, 45-860MHz, AGC optic, control electronic ( fara semireglabili) pentru tilt 0-15dB si atenuare 0-15dB, alimentare AC 150-265V, temperatura operare -40+60 grade Celsius, consum < 8W, dimensiuni 190x110x50mm.
Vezi fisa tehnica in sectiunea Download

Pret : 285.49 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Receptor Optic cale inversa nextraCOM NX-8602HReceptor Optic FTTH nextraCOM - NX-8602H

Receptor optic de interior HOME, DIODA PIN 1100-1600nm, -7+2dBm, SC/APC, iesire RF 47-860MHz, nivel 100dBuV, alimentare 60V sau 220V

Pret : 190.32 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
Nextra NX-8602 RJIII /NCReceptor Optic FTTB-control electronic nextraCOM - NX-8602 RJIII /NC

Receptor optic FTTB, intrare 1100-1600nm, nivel intrare -9+2dBm, conector SC/APC, 2 iesiri RF x 104dBuV, 45-860MHz, AGC optic, control electronic ( fara semireglabili). 
Atenuare 0-15dB / tilt 0-15dB, alimentare cu sursa 12VDC/1A, temperatura operare -40+60 grade Celsius, consum < 8,5W, dimensiuni 178x115x40mm.
Vezi fisa tehnica in sectiunea Download

Pret vechi: 285.49 RON
Pret nou:
228.39 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Receptor optic FTTH NextraCOM NX-8688MReceptor optic FTTH nextraCOM - NX-8688M

Receptor optic miniatura FTTH de interior, alimentare 12V DC, sensibilitate optica -7dBm, conector SC/APC, putere pe iesirea RF >= 88dB

Pret vechi: 85.65 RON
Pret nou:
76.13 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept