Curs valutar


1 EURO = 4.7537 RON  
1 USD = 4.3082 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


Receptoare de satelit digitale High Definition

  Descriere Pret
Vu+ Solo4KReceptor de satelit digital UHD 4K - Dual FBC Tuner VU PLUS - Vu+ SOLO 4K
  • Primul si cel mai rapid receptor UHD 4K de satelit din lume!!!
  • Tehnologie noua FBC (Full Band Capture) Dual DVB-S2 ce permite inregistrarea simultana a 8 posturi TV HD 
  • Posibilitate de instalare optionala a unui tuner suplimentar DVB-C si DVB-T2


Pret vechi 1,344.00 RON
Pret nou
1,259.00 RON
*) Pretul nu contine TVA
cuTVA: 1,498.21 RON
Disponibilitate : Sunati
Xfinity1Receptor de satelit HD Android XBMC Optibox - EVO XFinity

Receptor de satelit digital, MPEG-Fully DVB-S / DVB-S2 HD, Recording, Timeshift, 4000 ch., HD Video/Audio Output S/PDIF, LAN 10/100 Mbps Ethernet, USB 2.0 Host,  DiSEqC 1.0, 1.1, 1.2 and USALS, Games


Pret vechi 514.50 RON
Pret nou
300.00 RON
*) Pretul nu contine TVA
cuTVA: 357.00 RON
Disponibilitate : Sunati
ML-4100T2CReceptor 3in1 PVR HD DVB-C2 & DVB-T2 & IPTV STALKER Medialink - ML4100TC

Cel mai versatil Receptor de Cablu DVB-C2 (compatibil UPC si DIGI, ... transmise in clar) si cu ultimul standard  de transmisie Terestradigitala  DVB-T2 Medi@Link High Definition FTA cu modul usb -PVR, BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player, INTERNET RADIO conexiune ethernet 10/100 SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p.
Placa ethenet este integrata pe placa de baza.

Canalul oficial de prezentare MEDIALINK de pe youtube, cu clipurile oficiale de prezentare:

Pret vechi 230.00 RON
Pret nou
175.00 RON
*) Pretul nu contine TVA
cuTVA: 208.25 RON
Disponibilitate : Sunati
VU+ Zero fataReceptor de satelit digital HD VU PLUS - Vu+ Zero

There was one goal in developing ZERO from the beginning. Let’s make something more affordable to please more Vu+ fans. As the name stands for, suggests, ZERO is a remarkably competitive model pricewise while maintaining the performance and philosophy of Vu+ products.

This is why ZERO is the most affordable DVB-S2 HD Zapper of Vu+ ever.

Pret vechi 455.00 RON
Pret nou
403.40 RON
*) Pretul nu contine TVA
cuTVA: 480.05 RON
Disponibilitate : Sunati
AMIKO A4 COMBOReceptor combo DVB-S2, DVB-C/T2 digital 4K Amiko - AMIKO A4 COMBO
  • One S2 satellite & one T2 terrestrial / cable hybrid tuner
  • One card reader
  • Fast & easy installation
  • 64bit Quad Core 2.0GHz processor
  • 8GB integrated flash memory
  • 2 USB2.0 connections
  • Micro SD card expansion slot
  • Google Play™
  • YouTube videos
  • Based on Android™
  • Hundreds of thousands of available applications!
  • KODI media player support
  • Easy streaming to iOS, Android™ devices & PC’s
  • DLNA - Easy playback over local network
Pret vechi 410.00 RON
Pret nou
351.00 RON
*) Pretul nu contine TVA
cuTVA: 417.69 RON
Disponibilitate : Sunati
ML6500STCReceptor H.265 HEVC 5 in1 PVR HD DVB-C2 & DVB-T2 & IPTV STALKER Medialink - ML6500STC

Cel mai nou receptor 5 in 1 H.265 HEVC (DVB-S, DVB-C, DVB-T2, IPTV, H.265 mediaplayer) Medi@Link cu compresie H.265 HEVC, BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player, INTERNET RADIO conexiune ethernet 10/100 SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p.
Placa ethenet este integrata pe placa de baza.

Canalul oficial de prezentare MEDIALINK de pe youtube, cu clipurile oficiale de prezentare:

Pret vechi 370.00 RON
Pret nou
299.00 RON
*) Pretul nu contine TVA
cuTVA: 355.81 RON
Disponibilitate : Sunati
ULTIMO4KReceptor de satelit digital UHD 4K VU PLUS - ULTIMO 4K

Vu + Ultimo4K, cea mai performanta "nava amiral" Linux 4K de pe piața !!!

  • Receptorul UHD ofera trei plug & play sloturi pentru 2 tunere FBC duble și 1 dublu DVB-S2 sau DVB-C Tuner / T2
  • Un procesor 20000 DMIPS sub suportul HEVC pentru 4K transmițatoare Hood, care promite operarea rapida, comutare rapida ori precum și o mare libertate de mișcare.
  • 2 porturi CI și 2 cititoare de carduri pentru programele criptate
  • Posibilitatea de instalare a HDD intern de 2.5" sau 3.5“
  • 3GB de memorie RAM și 4 GB de memorie flash
  • O intrare HDMI 2.0
  • Conectivitate wireless cu WiFi dual-band inclusiv standardul AC rapid și Bluetooth 4.0.
  • În plus, sistemul de operare Enigma2 ofera funcții avansate TV, de rețea și internet.
Pret vechi 2,524.00 RON
Pret nou
2,202.00 RON
*) Pretul nu contine TVA
cuTVA: 2,620.38 RON
Disponibilitate : La comanda
Vu+ Solo SE V2Receptor de satelit digital HD VU PLUS - Vu+ SOLO SE V2
  • Powerful Dual Core CPU 1.3GHz
  • SOLO SE is equipped with dual core CPU 1.3 GHz, boasting the highest performance amongst all HD zappers on the market.You will be amazed with the faster booting speed, faster zapping, and faster software loading and a lot more.


Pret vechi 779.00 RON
Pret nou
432.00 RON
*) Pretul nu contine TVA
cuTVA: 514.08 RON
Disponibilitate : Sunati
USB-RJ45Receptor DVB-S2 PVR + IPTV STALKER & VOD Multimedia Medialink - ML1100S+LAN, IPTV STALKER

Cel mai versatil Receptor de satelit FTA-HD Medi@Link High Definition cu adaptor USB la RJ45 LAN inclus in pret.
BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player, INTERNET RADIO, SAMBA, PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p

Pret vechi 199.00 RON
Pret nou
129.00 RON
*) Pretul nu contine TVA
cuTVA: 153.51 RON
Disponibilitate : Sunati
ML-1100SReceptor satelit HD PVR + IPTV STALKER (Optional) Medialink - ML1100S

Cel mai versatil Receptor de satelit DVB-S2, Medi@Link High Definition pentru programe FTA - full HD transmise pe satelit, BLIND SCAN & FAST SCAN, USALT, PVR ( HDD extern USB-2TB max),
Ofera functii multimedia avansate IPTV CLIENT STALKER & XTREAM, (VOD RTMP, RTSP, http TS, M3U) functii avansate media player, INTERNET RADIO, SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p.

Permite accesarea direct din telecomanda a mii de programe TV over IPTV din toate tarile lumii si zeci de mii de VOD.
Canalul oficial de prezentare MEDIALINK de pe youtube, cu clipurile oficiale de prezentare:

Pentru functiile de IPTV sau Internet Multimedia este nevoie de adaptorul Wi-Fi sau adaptorul USB-RJ45 si acces la internet de mare viteza.

Braun Group - USB-RJ45 (Optional)

Medialink - WiFi Medialink 150Mbps mini-N USB Adapter +antena (Optional)


Pret vechi 179.00 RON
Pret nou
110.00 RON
*) Pretul nu contine TVA
cuTVA: 130.90 RON
Disponibilitate : Sunati
Amiko Micro HD SEReceptor de satelit High Definition de dimensiuni reduse Amiko - AMIKO MICRO HD SE

Receptor de satelit High Definition de dimensiuni reduse cu media player, card reader Conax si conexiune ethernet, senzor IR extern, redare mkv,avi,mpeg,ts,vob,mp3,jpeg, Iesire Full HD 1080p

Pret vechi 164.00 RON
Pret nou
127.00 RON
*) Pretul nu contine TVA
cuTVA: 151.13 RON
Disponibilitate : Sunati
ML1200 FataReceptor de satelit cu cititor Card, HD IPTV STALKER Multimedia Medialink - ML1200S

Cel mai versatil Receptor de satelit Medi@Link High Definition cu 1 Smart Card reader, BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player,
conexiune ethernet 10/100 SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p
Placa de retea RJ45 este integrata.

Pret vechi 210.00 RON
Pret nou
179.00 RON
*) Pretul nu contine TVA
cuTVA: 213.01 RON
Disponibilitate : Sunati
Receptor de satelit digital High Definition Optibox Gekko HDReceptor de satelit digital High Definition Optibox - Gekko HD

Receptor de satelit digital High Definition, Optibox Gekko, HDTV PVR Receiver ( H.264/ MPEG4 HD ),  Embedded Linux OS, Xvid file play back supported, Supports MPEG4 /MPEG2 - HD/SD and Fully DVB-S2 /DVB-S Compliant, Intelligent Blind Scan for both SD and HD TV & Multi-Satellite Search, Powerful Extended EPG supports and Event Recording

Pret vechi 442.74 RON
Pret nou
254.00 RON
*) Pretul nu contine TVA
cuTVA: 302.26 RON
Disponibilitate : Sunati
ML6200SReceptor de satelit H.265 HEVC cu cititor de Card HD IPTV STALKER Multimedia Medialink - ML6200S

Cel mai nou receptor de satelit Medi@Link cu compresie H.265 HEVC cu 1 Smart Card reader, BLIND SCAN & FAST SCAN cu functii multimedia si IPTV CLIENT STALKER & XTREAM, VOD (RTMP, RTSP, http TS, M3U) functii avansate media player,
conexiune ethernet 10/100 SAMBA,  PVR, 45k ADULT channels redare mkv, avi, divx, xvid mpeg, ts, vob, mp3, jpeg, DLNA, Live Weather, Google MAPS, Web album: Picasa, Flickr, Yupoo , Jocuri, meniu in limba Romana, Iesire Full HD 1080p
Placa de retea RJ45 este integrata.

Pret vechi 298.00 RON
Pret nou
219.00 RON
*) Pretul nu contine TVA
cuTVA: 260.61 RON
Disponibilitate : Sunati
Receptor de satelit digital Optibox KOALAReceptor de satelit digital high definition Optibox - KOALA

Recetor de satelit digital high definition PVR Ready, H.264/MPEG-4 - HD / DVB-S2 Tuner, 2 sloturi CI, 1 slot SmartCard, Linux OS, interfata RJ-45, USB 2.0, iesire video si audio (576i,576p,720p,1080i), PiP, SPDIF


Pret vechi 470.00 RON
Pret nou
290.00 RON
*) Pretul nu contine TVA
cuTVA: 345.10 RON
Disponibilitate : Sunati
Amiko A5 comboReceptor combo DVB-S2, DVB-C/T2 digital 4K Amiko - Amiko A5 Combo

- Procesor Quadcore A53 la 1.5 GHz 64bit CPU
- Nucleu video pentacore Mali-MP450
- HEVC Main10 H.265 2160p60
- Suport video HEVC si VP9
- Suport audio DTS si DD
- Chipset AML S-905D 1.5 GHz
- 2 Gb RAM DDR3
- 16 Gb flash EMMC
- Tuner Combo DVB-S2 / DVB-T2 / DVB-C
- Port ethernet Gigabit 1Gbit
- Wi-Fi dual band 2.4 / 5 GHz
- Cardreader Conax
- SD card ( up to 32 Gb )
- USB 2.0
- Android 7.1.2 / dualboot Enigma2
- Enigma2 OpenATV 6.2 ( SD card )
- DTV LinkDroid
- Kodi 17.6
- YouTube 4K
- NetFlix 4K

Pret vechi 518.00 RON
Pret nou
440.00 RON
*) Pretul nu contine TVA
cuTVA: 523.60 RON
Disponibilitate : Sunati
amiko_impulse_sat_frontReceptor de satelit digital Amiko High Definition Amiko - Amiko Impulse SAT

Receptor satelit DVB-S2, MPEG4 ( Full HD 1080p, Ethernet, USB Wi-Fi support. 

Pret : 129.00 RON
*) Pretul nu contine TVA
cuTVA: 153.51 RON
Disponibilitate : Sunati
Receptor de satelit Combo TSCXReceptor de satelit Combo Opticum - TSCX COMBO

COMBO: TER.+SAT. COMBO Receiver with Dual USB, VFD Display, 2 SCART, 4 RCA, S/PDIF, CARD READER, UHF Modulator, 2 x USB

Pret : 247.19 RON
*) Pretul nu contine TVA
cuTVA: 294.16 RON
Disponibilitate : Sunati
HD8150Receptor de satelit digital High Definition CXE PVR Amiko - AMIKO HD8150
  • Conax Embedded Card Reader
  • MKV, AVI, MPEG, TS, VOB, MP3, JPEG Playback
  • Channel Recording to External Storage Devices
  • Full HD 1080p Output
  • YouTube Videos
  • Ethernet Connection & USB WiFi Support (Ralink RT5370 chip only)
  • Two High Speed USB2.0 Slots
Pret vechi 179.80 RON
Pret nou
169.00 RON
*) Pretul nu contine TVA
cuTVA: 201.11 RON
Disponibilitate : Sunati
Vu+ DVB-C/T/T2Tuner DVB-C/T/T2 Universal pentru receptorul Vu+ VU PLUS - Vu+ DVB-C/T/T2
  • Plug and Play DVB-C/T/T2 Universal pentru Vu+
Pret : 198.00 RON
*) Pretul nu contine TVA
cuTVA: 235.62 RON
Disponibilitate : Sunati
Receptor de satelit HD Opticum HD 9600Receptor de satelit High Definition Opticum - 9600 HD

Receptor de satelit High Definition Opticum HD 9600, MPEG4 AVC/H.264, 2 sloturi CI, 2x Card Reader, SCART, S/PDIF, 1.2, IR connector, RS232, Ethernet

Pret vechi 551.00 RON
Pret nou
447.00 RON
*) Pretul nu contine TVA
cuTVA: 531.93 RON
Disponibilitate : Sunati
amiko_impulse_t2c_frontReceptor de cablu si digital T2 Terestru Amiko High Definition Amiko - Amiko Impulse T2/C

Receptor de cablu si teresttru T2 , MPEG4 Full HD 1080p, Ethernet, USB Wi-Fi support. 

Pret : 129.00 RON
*) Pretul nu contine TVA
cuTVA: 153.51 RON
Disponibilitate : Sunati
8140aReceptor de satelit digital High Definition CICXE PVR Amiko - AMIKO SHD-8140
  • One Conax Embedded Card Reader
  • MKV, AVI, MPEG, TS, VOB, MP3, JPEG Playback
  • Channel Recording to External Storage Devices
  • Full HD 1080p Output
  • YouTube Videos
  • USB WiFi Support (Ralink RT5370 chip only)
  • One High Speed USB2.0 Slots
Pret : 203.00 RON
*) Pretul nu contine TVA
cuTVA: 241.57 RON
Disponibilitate : Sunati
Vu+ Remote ControlTelecomanda Vu+ qwerty VU PLUS - Vu+ RCU qwerty

View Technical specification

  • Universal Remote Control for Vu+
  • Includes QWERTY keyboard for comfortable typing of even longer texts
  • The remote control can also turn on/off your TV
Pret : 99.50 RON
*) Pretul nu contine TVA
cuTVA: 118.41 RON
Disponibilitate : La comanda
Receptor de satelit digital VU Plus Zero4 KReceptor de satelit digital VU Plus Zero4 K VU PLUS - VU Plus Zero 4K

Dual core 1.5GHz and 2GB DDR4 realizes faster channel zapping and loading speed.

Entering 4K HDR (High Dynamic Range) era, Colors are now more natural and brighter.

Two tuner types are available : Single DVB-S2X or Single DVB C/T2.

With PLUG, ZERO4K becomes more exquisite.

Pret vechi 623.00 RON
Pret nou
585.00 RON
*) Pretul nu contine TVA
cuTVA: 696.15 RON
Disponibilitate : Sunati
Amiko 8250Receptor de satelit digital High Definition CICXE PVR Amiko - AMIKO HD8250+
  • Conax Embedded Card Reader
  • Common Interface
  • MKV, AVI, MPEG, TS, VOB, MP3, JPEG Playback
  • Channel Recording to External Storage Devices
  • Full HD 1080p Output
  • YouTube Videos
  • Ethernet Connection & USB WiFi Support (Ralink RT5370 chip only)
  • Two High Speed USB2.0 Slots
Pret vechi 241.00 RON
Pret nou
199.00 RON
*) Pretul nu contine TVA
cuTVA: 236.81 RON
Disponibilitate : Sunati
Vu+ DVB-S2 Twin tunerTuner dublu DVB-S2 pentru receptorul Vu+ VU PLUS - Vu+ DVB-S2 Twin tuner
  • Plug and Play Twin DVB-S2 tuner for Vu+ products
Pret : 285.00 RON
*) Pretul nu contine TVA
cuTVA: 339.15 RON
Disponibilitate : Sunati
Vu+ DVB-S2 tunerTuner DVB-S2 pentru receptorul Vu+ VU PLUS - Vu+ DVB-S2 tuner
  • Plug and Play DVB-S2 tuner for Vu +
  • Install additional tuners to watch and record multiple programs simultaneously
  • The tuner includes LNB LNB IN and OUT
Pret vechi 163.00 RON
Pret nou
155.00 RON
*) Pretul nu contine TVA
cuTVA: 184.45 RON
Disponibilitate : Sunati
Dual Tuner DVB-C/T2Tuner dublu DVB-C/T2 pentru receptorul Vu+ VU PLUS - Dual Tuner DVB-C/T2
  • Tuner dual DVB-C2/T2 pentru Vu+ Duo2/ Solo SE V2/ Ultimo/ Uno
  • Plug and Play
  • Comutatie din software DVB-C/ DVB-T/ T2
  • Bucla intre tunerele integrate
Pret : 287.00 RON
*) Pretul nu contine TVA
cuTVA: 341.53 RON
Disponibilitate : La comanda
Vu+ Tuner FBC DVB-C v2Vu+ Tuner FBC 8 x DVB-C (cablu) v.2 VU PLUS - Vu+ Tuner FBC DVB-C v2

Tunerul Vu+ dublu FBC (Full Band Capture) este compatibil cu modelele Ultimo 4K, Uno 4K, Uno 4K SE si Duo 4K. Acest tuner FBC are 8 demodulatoare, functionand ca si 8 tunere individuale. Asadar poate receptiona canale de la 8 muxuri (transpondere) simultan.

Pret : 337.00 RON
*) Pretul nu contine TVA
cuTVA: 401.03 RON
Disponibilitate : Sunati
VU Plus Uno 4K SEReceptor de satelit digital VU Plus Uno 4K SE VU PLUS - VU Plus Uno 4K SE

Powerful dual core 1.7GHz CPU and 2GB DDR4
Ensures the maximum performance.With 4K HDR (High Dynamic Range),
UNO 4K SE delivers outstanding picture quality.
Experience real and vivid images.

Pret vechi 1,345.00 RON
Pret nou
1,108.00 RON
*) Pretul nu contine TVA
cuTVA: 1,318.52 RON
Disponibilitate : Sunati
7700HDCICXReceptor de Satelit High Definition Opticum - 7700HDCICX

Digital HD receiver with full options, CARD READER and Common Interface, output, cable included

Pret vechi 795.00 RON
Pret nou
150.00 RON
*) Pretul nu contine TVA
cuTVA: 178.50 RON
Disponibilitate : Sunati
Receptor Terestrial Amiko T60 T2Receptor Terestrial Amiko T60 T2 Amiko - Amiko T60

One High Speed USB 2.0 Connection

Full HD (1080p) Output via HDMI

Channel Recording to External Storage Devices

Timeshift support

Channel Recording & Timeshifting Simulteniously (optional)

True-color, User Friendly On-Screen Display (OSD)

Full Picture In Graphic (PIG) function

Electronic Program Guide (EPG) for on screen channel information

Subtitle supported

Pret : 73.90 RON
*) Pretul nu contine TVA
cuTVA: 87.94 RON
Disponibilitate : Sunati
HD8265Receptor Combo Amiko HD8265+ DVB-S2 + DVB-C + DVB-T2 Amiko - Amiko HD8265+

One Conax Embedded card reader

One Common Interface slot

HEVC decoding support

6000 channels (TV and Radio) programmable

Two High Speed USB 2.0 Connections

Ethernet Connection & USB WiFi Support (Ralink RT5370 chip only)

YouTube videos (feature subject to availability)

RSS Reader & Weather Forecast Function

Channel Recording to External Storage Devices (optional)

Timeshift support

Pret vechi 227.00 RON
Pret nou
213.00 RON
*) Pretul nu contine TVA
cuTVA: 253.47 RON
Disponibilitate : Sunati
Optibox UltraReceptor de satelit digital high definition cu cititor Conax Optibox - Optibox Ultra

Recetor de satelit digital high definition PVR Ready, H.264/MPEG-4 - HD / DVB-S2 Tuner, 1 slot SmartCard Conax, USB 2.0, iesire video si audio (576i,576p,720p,1080i)

Optibox Ultra este o versiune ușoar a receptorului Optibox CX PVR EXTRA. Are o ieșire HDMI. Receptorul are dimensiuni mici, panoul frontal dispune de o interfaț USB pentru a înregistra programul vizualizat pe un HDD extern sau un FlashDisk. 

Pret : 116.00 RON
*) Pretul nu contine TVA
cuTVA: 138.04 RON
Disponibilitate : Sunati
Amiko Mira WiFiReceptor Satelit Amiko Mira DVB-S2 Amiko - Amiko Mira WiFi

One Conax Embedded card reader

6000 channels (TV and Radio) programmable

External IR Sensor (Included in the package)

Mountable on TV (Sticker included in the package)

One High Speed USB 2.0 Connection

Built in Wireless-N WiFi connection

YouTube videos (3rd party content, subject to availability)

RSS Reader & Weather Forecast Functions (WiFi connection required)

DiSEqC 1.0, 1.1, 1.2 and USALS Compatible

Full HD (1080p) Output via HDMI

Channel Recording to External Storage Devices

Pret vechi 165.00 RON
Pret nou
129.00 RON
*) Pretul nu contine TVA
cuTVA: 153.51 RON
Disponibilitate : In asteptare
Amiko MiraReceptor Satelit Amiko Mira DVB-S2 Amiko - Amiko Mira

One Conax Embedded card reader

6000 channels (TV and Radio) programmable

External IR Sensor (Included in the package)

Mountable on TV (Sticker included in the package)

One High Speed USB 2.0 Connection

USB WiFi Support (Ralink RT5370 chip only)

YouTube videos (3rd party content, subject to availability)

RSS Reader & Weather Forecast Functions (WiFi connection required)

DiSEqC 1.0, 1.1, 1.2 and USALS Compatible

Full HD (1080p) Output via HDMI

Channel Recording to External Storage Devices

Pret vechi 150.00 RON
Pret nou
119.00 RON
*) Pretul nu contine TVA
cuTVA: 141.61 RON
Disponibilitate : Sunati
Vu+ DUO 4KReceptor de satelit digital VU Plus DUO 4K VU PLUS - Vu+ DUO 4K
  • Quad Core 2.1GHz
  • 1x Dual FBC-S2/S2X tuner
  • Faster booting and channel changingDuo4K is boosted with a high-performance Quad core 2.1GHz CPU and 2GB LPDDR4
  • Two Common Interfaces, two streams simultaneouslyTwo CI descramble two streams at the same time.
  • Detachable 2.5”HDD SlotThe bigger slot(15mm) enables the capacity up to 4TB.
  • Transcoding
  • HDMI In & HDMI Out
  • Detachable 2.5” HDD
  • HDR10/HLG
  • 2 x USB 3.0(Rear) & 1 x USB 2.0(Front)
  • 2 x Common Interface/1x Smart Card
  • 3.5” LCD for Mini TV
  • Advanced tuner system for any possible tuner configurationOne FBC tuner supports 8 demodulators. Two slots make it 16 demodulators totally.
    • Slot A : FBC DVB-S2X, FBC-C V1/V2 and Dual T2(MTISF) Tuner
    • Slot B : FBC DVB-S2X, FBC-C V2 and Dual T2(MTISF) Tuner
    * FBC-C V1 Tuner can only be connected to slot A.
Pret : 1,500.00 RON
*) Pretul nu contine TVA
cuTVA: 1,785.00 RON
Disponibilitate : Sunati
TF7720Receptor de satelit digital Topfield Topfield - TF7720

Suport pentru MPEG-2, MPEG-4, H.264 compatibil DVB
DiSEqC 1.0, 1.1, 1.2 si USALS(DiSEqC 1.3)
5000 canale (TV si Radio) programabile
Meniu in mai multe limbi
30 Liste favoriti
OSD True-color
Suport subtitrare
Blocare parentala
Upgrade firmware prin USB 2.0
Transfer firmware si date din receptor in receptor
S/PDIF audio digital si AC-3
USB 2.0
Decodare mp3 (MPEG-1 Layer 3)
Iesire Component (YPbPr)

Pret vechi 531.00 RON
Pret nou
250.00 RON
*) Pretul nu contine TVA
cuTVA: 297.50 RON
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept