Curs valutar

11-Dec-2019

1 EURO = 4.7787 RON  
1 USD = 4.3149 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan

ANPC

Receptoare optice fara cale inversa, etanse pentru montare exterioara

 
  Descriere Pret
Receptor Optic de exterior NextraCOM NX-8602MCReceptor Optic de exterior nextraCOM - NX-8602MC

Receptor optic etans de exterior,  DIODA PIN -7+2dB, 1100-1600nm, conector SC/APC, 2 ies RFx102dBuV (1 hibrid RF)

Pret : 246.10 RON
*) Pretul nu contine TVA
cuTVA: 292.86 RON
Disponibilitate : Sunati
Receptor Optic de exterior Maiwei MW-ONU-41Receptor Optic de exterior Braun_Group - MW-ONU-41

Receptor optic etans de exterior, -7+2dB, 1100-1600nm, conector SC/APC, 2 ies RFx102dBuV (1 hibrid RF), alimentare 220V sau 60V, dimensiuni : 250x140x100mm

Pret vechi 246.10 RON
Pret nou
221.49 RON
*) Pretul nu contine TVA
cuTVA: 263.58 RON
Disponibilitate : Sunati
Receptor Optic nextraCOM GA-8130LReceptor Optic nextraCOM - GA-8130L

1310nm, receptor optic cu DIODA PIN, conector SC/APC, 2 ies RFx102dBµV (1 hibrid Philips)

Pret : 369.15 RON
*) Pretul nu contine TVA
cuTVA: 439.29 RON
Disponibilitate : Sunati
Receptor Optic Maiwei MW2002(OR)Receptor Optic Braun_Group - MW2002(OR)

1290-1600nm, receptor optic cu modul Philips -7dBm, conector SC/APC, 2 iesiri RF(1 hibrid) 45-860MHz nivel RF 102dBmV, sursa in comut 100-240V sau telealim 30-90VAC

Pret : 738.31 RON
*) Pretul nu contine TVA
cuTVA: 878.59 RON
Disponibilitate : Sunati
Receptor Optic nextraCOM GA-8230PReceptor Optic nextraCOM - GA-8230PL

Receptor optic cu modul Philips -7dBm (1290-1600nm), conector SC/APC, 2 iesiri RFx102dBµV (1 hibrid Philips) 

Pret : 738.31 RON
*) Pretul nu contine TVA
cuTVA: 878.59 RON
Disponibilitate : Sunati
Receptor Optic Maiwei MW2002(OR)-PINReceptor Optic Braun_Group - MW2002(OR)-PIN

1310+/-20nm, receptor optic cu DIODA PIN -1dBm, conector SC/APC, 2 iesiri RF(1 hibrid) 45-860MHz nivel RF 102dBmV, sursa in comut 100-240V sau telealim 30-90VAC

Pret : 369.15 RON
*) Pretul nu contine TVA
cuTVA: 439.29 RON
Disponibilitate : Sunati
Receptor Optic Braun_Group - MW2006(OR)

1310nm, receptor optic cu dioda PIN, conect. SC/APC, 4 ies RFx102dBuV (3 hibrizi Philips)

Pret : 836.75 RON
*) Pretul nu contine TVA
cuTVA: 995.73 RON
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept