Curs valutar


1 EURO = 4.7352 RON  
1 USD = 4.2979 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Routere wireless

Range Extender Wireless N 300Mbps

Range Extender Wireless N 300Mbps

TP-Link - TL-WA830RE

Amplificatorul de semnal Wireless N 300Mbps TP-Link TL-WA830RE este conceput pentru a extinde acoperirea si puterea semnalului în cazul unei retele wireless existente, pentru eliminarea zonelor fara semnal. Combinând tehnologiile wireless N, securitatea sporita si compatibilitatea extinsa, TL-WA830RE reprezinta o soluuie securizata de mare viteza care va permite sa îmbunatati considerabil acoperirea unei retele, fara a renunta la aceasta, oferindu-ți libertatea de a te bucura de Internet fara întreruperi oriunde, în spatii vaste ca locuinte sau birouri, fara a va face probleme în legatura cu limitarile de acoperire.

Alte imagini:
Range Extender Wireless N 300MbpsRange Extender Wireless N 300MbpsRange Extender Wireless N 300MbpsRange Extender Wireless N 300Mbps
Range Extender Wireless N 300Mbps
Pret fara TVA:
95.00 RON

Pret cu TVA :
113,05 RON

Disponibilitate :

Interfața One 10/100M Ethernet Port(RJ45)
Butoane Range Extender Button
Reset Button
Power On/Off Button
Consum Energie 3W
Antena 2*5dBi Fixed Antennas
Alimentare Externa 9V-0.6A
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Dimensiuni (L x l x H) 7.1*4.9*1.4 in.(181*125*36mm)
Frecvența 2.4~2.4835GHz
Rata de Semnal 11n: Up to 300Mbps(dynamic)
11g: Up to 54Mbps(dynamic)
11b: Up to 11Mbps(dynamic)
Sensibilitate Receptor 270M: -68dBm@10% PER
130M: -68dBm@10% PER
108M: -68dBm@10% PER
54M: -68dBm@10% PER
11M: -85dBm@8% PER
6M: -88dBm@10% PER
1M: -90dBm@8% PER
Putere de Transmisie < 20 dBm (EIRP)
Mod Wireless Range Extender Mode, AP Mode
Funcții Wireless Wireless MAC Address Filtering
Enable/Disable Wireless Radio
Enable/Disable Wireless SSID Broadcast
AP Isolation
Wireless Statistic
Domain Login Function
Securitate Wireless 64/128/152-bit WEP
Certificari CE, FCC, RoHS
Conținut Pachet 300Mbps Wi-Fi Range Extender TL-WA830RE
Power Adapter
RJ-45 Ethernet Cable
Quick Installation Guide
Cerințe de sistem Microsoft Windows 98SE, NT, 2000, XP, Vista, Windows 7, 8, 8.1, 10, Mac OS X, NetWare, UNIX or Linux
Mediu Operating Temperature: 0°C~40°C (32°F~104°F)
Storage Temperature: -40°C~70°C (-40°F~158°F)
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing

Viteza si acoperire wireless N

Adoptând tehnologia avansata 802.11n MIMO (Multi Input Multi Output), TL-WA830RE functioneaza simultan prin intermediul a doua antene pentru transmisie si receptie, pentru a depasi interferentele si degradarea semnalului atunci când este utilizat pe distante lungi sau prin bariere fizice într-un birou mic sau un apartament de mari dimensiuni, rezultând o îmbunatatire considerabila a performansei wireless, chiar si în cladiri din beton armat. Mai mult, semnalul wireless poate fi detectat cu usurinta pe distante extinse, acolo unde produsele 11g conventionale nu permit acest lucru!

Extindere wireless surprinzatoare

TL-WA830RE utilizeaza modul Range Extender ca mod wireless implicit, functionând ca amplificator de semnal pentru a retransmite impecabil semnalul wireless pe distante mai mari în locatii care anterior se aflau în afara ariei de acoperire a retelei wireless existente. Datorita tehnologiei Wireless N de ultima ora, acesta poate depasi obstacolele si poate spori calitatea generala a semnalului, oferind o conexiune stabila la retea identica cu o retea wired. Mai mult, TL-WR830RE poate functiona în modul AP conventional, accesând Internetul prin intermediul unui modem de cablu/ADSL si conectând reteaua wireless cu cea wired.

Conectare prin simpla apasare a unui buton

TL-WA830RE permite utilizatorilor sa creeze o conexiune wireless cu o retea nesecurizata, prin simpla apasare a butonului Range Extender .


Compatibilitate deplina cu dispozitive 802.11b/g/n

Amplificatorul de semnal wireless N TP-Link TL-WA830RE este perfect compatibil cu produsele IEEE 802.11b/g/n, inclusiv routere, puncte de acces sau adaptoare. Acesta nu doar ca maximizeaza performantele produselor 802.11n, dar ajuta la obtinerea capacitatilor maxime atunci când este conectat cu dispozitive 801.11b/g. De aceea poti utiliza la maxima capacitate dispozitivele wireless existente fara a fi nevoie de înlocuiri costisitoare, si chiar te ajuta sa realizezi un upgrade al retelei wireless la generatia wireless N.

Securitate avansata WPA/WPA2

În ceea ce priveste securitatea conexiunii Wi-Fi, criptarea WEP nu mai este cea mai puternica si sigura metoda de protectie împotriva amenintarilor exterioare. TL-WA830RE ofera posibilitati de criptare WPA/WPA2 (Personal si Enterprise) dezvoltate de grupul Wi-Fi Alliance, protejând reteaua wireless de amenintarile exterioare.

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept