Curs valutar

17-Nov-2019

1 EURO = 4.7667 RON  
1 USD = 4.3224 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavecablu utpstabilizator de tensiuneswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolodoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpower

ANPC

 » Routere wireless



Range Extender Universal Wi-Fi 300Mbps

Range Extender Universal Wi-Fi 300Mbps

TP-Link - TL-WA850RE

Modul de functionare Range Extender creste semnalul wireless in zonele fara semnal sau in zonele greu accesibile cu ajutorul cablului.Extinde usor semnalul wireless doar prin apasarea butonului Range Extender.Portul Ethernet permite Extender-ului sa functioneze ca un adaptor wireless pentru conectarea dispozitivelor care folosesc cablu de retea.

 

 
Alte imagini:
Range Extender Universal Wi-Fi 300MbpsRange Extender Universal Wi-Fi 300Mbps





Pret vechi fara TVA :
85,00 RON


Pret nou fara TVA :
70,00 RON

Pret nou cu TVA :
83,30 RON

Disponibilitate :
In stoc

CARACTERISTICI HARDWARE
Tip Priza EU
Interfața 1 Port Ethernet (RJ45) 10/100
Butoane Buton RE (Range Extender), Buton Reset
Consum Energie Aproximativ 3W
Antena 2 Antene interne
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Dimensiuni (L x l x H) 110.0 x 65.8 x 75.2mm
CARACTERISTICI WIRELESS
Frecvența 2.4~2.4835GHz
Rata de Semnal 11n: Pâna la 300Mbps (dinamic)
11g: Pâna la 54Mbps (dinamic)
11b: Pâna la 11Mbps (dinamic)
Sensibilitate Receptor 270M: -68dBm@10% PER
130M: -68dBm@10% PER
108M: -68dBm@10% PER
54M: -68dBm@10% PER
11M: -85dBm@8% PER
6M: -88dBm@10% PER
1M: -90dBm@8% PER
Putere de Transmisie < 20 dBm (EIRP)
Mod Wireless Range Extender/Access Point
Funcții Wireless WMM (Wi-Fi Multimedia)
Filtrarea adreselor MAC Wireless
Statistici Wireless
Funcție pentru conectare domeniu
Securitate Wireless 64/128/152-bit WEP
WPA-PSK / WPA2-PSK
ALTELE
Certificari CE, RoHS
Conținut Pachet Range Extender Wi-Fi Universal 300Mbps TL-WA850RE
Ghid de instalare rapida
Cerințe de sistem Microsoft® Windows® 98SE, NT, 2000, XP, Vista or Windows 7, 8, 10, Mac® OS, NetWare®, UNIX® or Linux.
Mediu Temperatura de funcționare: 0℃~40℃
Temperatura de depozitare: -40℃~70℃
Umiditatea mediului în care funcționeaza: 10%~90% fara condens
Umiditatea mediului în care este depozitat: 5%~90% fara condens

 

Ce face acest produs

TP-LINK TL-WA850RE este proiectat pentru a extinde convenabil acoperirea si pentru a imbunatati puterea semnalului retelei wireless existente, eliminand astfel zonele fara semnal. Cu viteza wireless N de 300Mbps, butonul Range Extender, dimensiunea sa miniaturala si posibilitatea de a fi montat pe perete, extinderea retelei wireless nu a fost niciodata mai usor de realizat. Mai mult, portul Ethernet face ca TL-WA850RE sa functioneze ca un adaptor wireless pentru a transforma o retea cu fir, in una fara fir.

 

Range Extender 300Mbps

TL-WA850RE este proiectat pentru a extinde acoperirea si a imbunatati puterea semnalului unei retele wireless existente, astfel eliminandu-se zonele fara semnal. In plus ajuta utilizatorii in mentinerea unei retele wireless si imbunatateste foarte mult raza de acoperire a acesteia. Cu viteza de 300Mbps folosita de catre standardul 802.11n, acest dispozitiv este ideal pentru vizionari video HD, streaming audio si jocuri online.

 

Desfasurare flexibila

Dimensiunea miniaturala a dispozitivului si designul sau care permite montarea pe perete, face dispozitiv usor de implementat si foarte flexibil. Mai mult, TL-WA850RE poate tine minte retelele wireless la care a fost conectat, nefiind nevoie sa fie resetat atunci cand este inlocuit routerul la care este conectat.

 

Plug and Play

Fara ajutorul altor fire sau cabluri, utilizatorii aflati in raza de acoperire a retelei wireless, pot extinde aceasta retea doar prin apasarea butonului WPS aflat pe routerul lor, urmat de butonul Range Extender aflat pe TL-WA850RE sau invers. O apasare suplimentara a butonului Pair (Grupare) poate stabili rapid o conexiune criptata cu dispozitivele client.

 

Ethernet Bridge

Singurul port Ethernet al dispozitivului TL-WA850RE permite Extender-ului sa functioneze ca un adaptor wireless pentru a conecta dispozitivele cu fir cum ar fi playere Blu-ray®, console de jocuri, DVR-uri si televizoare cu Internet. In acelasi timp, dispozitivul poate partaja reteaua wireless.

 

Indicator de lumina inteligent

Cele 5 leduri sunt folosite pentru a afla puterea semnalului wireless pe care TL-WA850RE il primeste de la routerul cu care comunica, acestea ajutand in a gasi locatia ideala pentru a plasa range extender-ul. Astfel TL-WA850RE poate furniza o raza de acoperire optima si o performanta foarte buna a retelei.

 
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept