Curs valutar

23-Jul-2019

1 EURO = 4.7231 RON  
1 USD = 4.2103 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km

ANPC

 » Routere wireless



Range Extender Universal Wi-Fi 300Mbps

Range Extender Universal Wi-Fi 300Mbps

TP-Link - TL-WA850RE

Modul de functionare Range Extender creste semnalul wireless in zonele fara semnal sau in zonele greu accesibile cu ajutorul cablului.Extinde usor semnalul wireless doar prin apasarea butonului Range Extender.Portul Ethernet permite Extender-ului sa functioneze ca un adaptor wireless pentru conectarea dispozitivelor care folosesc cablu de retea.

 

 
Alte imagini:
Range Extender Universal Wi-Fi 300MbpsRange Extender Universal Wi-Fi 300Mbps
Pret fara TVA:
85.00 RON

Pret cu TVA :
101,15 RON

Disponibilitate :
In stoc

CARACTERISTICI HARDWARE
Tip Priz„ EU
Interfaț„ 1 Port Ethernet (RJ45) 10/100
Butoane Buton RE (Range Extender), Buton Reset
Consum Energie Aproximativ 3W
Anten„ 2 Antene interne
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Dimensiuni (L x l x H) 110.0 x 65.8 x 75.2mm
CARACTERISTICI WIRELESS
Frecvenț„ 2.4~2.4835GHz
Rat„ de Semnal 11n: Pân„ la 300Mbps (dinamic)
11g: Pân„ la 54Mbps (dinamic)
11b: Pân„ la 11Mbps (dinamic)
Sensibilitate Receptor 270M: -68dBm@10% PER
130M: -68dBm@10% PER
108M: -68dBm@10% PER
54M: -68dBm@10% PER
11M: -85dBm@8% PER
6M: -88dBm@10% PER
1M: -90dBm@8% PER
Putere de Transmisie < 20 dBm (EIRP)
Mod Wireless Range Extender/Access Point
Funcții Wireless WMM (Wi-Fi Multimedia)
Filtrarea adreselor MAC Wireless
Statistici Wireless
Funcție pentru conectare domeniu
Securitate Wireless 64/128/152-bit WEP
WPA-PSK / WPA2-PSK
ALTELE
Certific„ri CE, RoHS
Conținut Pachet Range Extender Wi-Fi Universal 300Mbps TL-WA850RE
Ghid de instalare rapid„
Cerințe de sistem Microsoft® Windows® 98SE, NT, 2000, XP, Vista or Windows 7, 8, 10, Mac® OS, NetWare®, UNIX® or Linux.
Mediu Temperatur„ de funcționare: 0℃~40℃
Temperatur„ de depozitare: -40℃~70℃
Umiditatea mediului în care funcționeaz„: 10%~90% f„r„ condens
Umiditatea mediului în care este depozitat: 5%~90% f„r„ condens

 

Ce face acest produs

TP-LINK TL-WA850RE este proiectat pentru a extinde convenabil acoperirea si pentru a imbunatati puterea semnalului retelei wireless existente, eliminand astfel zonele fara semnal. Cu viteza wireless N de 300Mbps, butonul Range Extender, dimensiunea sa miniaturala si posibilitatea de a fi montat pe perete, extinderea retelei wireless nu a fost niciodata mai usor de realizat. Mai mult, portul Ethernet face ca TL-WA850RE sa functioneze ca un adaptor wireless pentru a transforma o retea cu fir, in una fara fir.

 

Range Extender 300Mbps

TL-WA850RE este proiectat pentru a extinde acoperirea si a imbunatati puterea semnalului unei retele wireless existente, astfel eliminandu-se zonele fara semnal. In plus ajuta utilizatorii in mentinerea unei retele wireless si imbunatateste foarte mult raza de acoperire a acesteia. Cu viteza de 300Mbps folosita de catre standardul 802.11n, acest dispozitiv este ideal pentru vizionari video HD, streaming audio si jocuri online.

 

Desfasurare flexibila

Dimensiunea miniaturala a dispozitivului si designul sau care permite montarea pe perete, face dispozitiv usor de implementat si foarte flexibil. Mai mult, TL-WA850RE poate tine minte retelele wireless la care a fost conectat, nefiind nevoie sa fie resetat atunci cand este inlocuit routerul la care este conectat.

 

Plug and Play

Fara ajutorul altor fire sau cabluri, utilizatorii aflati in raza de acoperire a retelei wireless, pot extinde aceasta retea doar prin apasarea butonului WPS aflat pe routerul lor, urmat de butonul Range Extender aflat pe TL-WA850RE sau invers. O apasare suplimentara a butonului Pair (Grupare) poate stabili rapid o conexiune criptata cu dispozitivele client.

 

Ethernet Bridge

Singurul port Ethernet al dispozitivului TL-WA850RE permite Extender-ului sa functioneze ca un adaptor wireless pentru a conecta dispozitivele cu fir cum ar fi playere Blu-ray®, console de jocuri, DVR-uri si televizoare cu Internet. In acelasi timp, dispozitivul poate partaja reteaua wireless.

 

Indicator de lumina inteligent

Cele 5 leduri sunt folosite pentru a afla puterea semnalului wireless pe care TL-WA850RE il primeste de la routerul cu care comunica, acestea ajutand in a gasi locatia ideala pentru a plasa range extender-ul. Astfel TL-WA850RE poate furniza o raza de acoperire optima si o performanta foarte buna a retelei.

 
UtilizńÉm cookie-uri pentru a √ģmbunńÉtńÉ»õi experien»õa site-ului »ôi pentru a analiza traficul »ôi publicul pe site. Continu√Ęnd sńÉ naviga»õi pe site-ul nostru, sunte»õi de acord cu acceptarea utilizńÉrii cookie-urilor √ģn conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale »ôi a»õi notat NotńÉ de procesare a informa»õiilor personale. Accept