Curs valutar

09-Jul-2020

1 EURO = 4.8406 RON  
1 USD = 4.2942 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszh

ANPC

 » Placi de retea wireless, Placi PCMCIA wireless, USB wireless



Adaptor PCI Wireless N 150Mbps TP-Link TL-WN751ND

Placa retea, Adaptor PCI Wireless N 150Mbps, antena detasabila

TP-Link - TL-WN751ND

Adaptor wireless N 150Mbps PCI, Atheros, 1T1R, 2.4GHz, 802.11n/g/b, 1 antena detasabila

Pret fara TVA:
47.00 RON

Pret cu TVA :
55,93 RON

Disponibilitate :
Sunati

TP-Link TL-WN751ND - Adaptor PCI Wireless N 150Mbps
Caracteristici esen�iale:
  • Rate de transfer wireless de pân� la 150Mbps
  • Dispune de interfa�� PCI 32-bi�i
  • Op�iuni de securitate avansat� cu posibilit��i de criptare WPA/WPA2
  • Administrare simpl� prin intermediul utilitarului inclus
Descriere

Ce face acest produs

TP-LINK TL-WN751ND este conceput pentru a oferi performan�e wireless complete pentru întreaga re�ea, de la servere �i backbone la switch-uri �i chiar pân� la computere desktop prin intermediul interfe�ei PCI. Adaptorul wireless N PCI TL-WN751ND dispune de compatibilitate extins�, putând fi conectat în orice slot standard PCI 32-bi�i. Comparativ cu pl�cile de re�ea PCI standard, acesta ofer� o l��ime de band� ridicat�, stabilitate �i func�ionalitate crescut�, oferind utilizatorilor posibilitatea de a beneficia de o conexiune rapid� �i avansat� pentru download, apeluri pe internet �i streaming video.

Wireless N - vitez� �i acoperire

Respectând standardul IEEE 802.11n, TL-WN751ND poate stabili cu u�urin�� o re�ea wireless �i poate atinge o vitez� de transmisie �i o arie de acoperire de 9 ori, �i respectiv de 4 ori, mai mare decât produsele 11g conven�ionale. Comparativ cu produsele 54M conven�ionale, TL-WN751ND asigur� performan�e ridicate, oferind utilizatorilor o experien�� excelent� de navigare pe Internet, pentru partajarea resurselor �i vizualizarea clipurilor video.

Criptare WPA / WPA2 - securitate avansat�

În ceea ce prive�te securitatea conexiunii WI-FI, criptarea WEP nu mai este considerat� cea mai puternic� �i sigur� metod� de protec�ie împotriva intruziunilor exterioare. TL-WN751ND ofer� posibilit��i de criptare WPA/WPA2 dezvoltate de grupul WI-FI Alliance, oferind o protec�ie eficient� a re�elei wireless împotriva amenin��rilor din exterior.

Securizare wireless rapid�

Compatibil cu WPS (WI-FI Protected Setup™), TL-WN751ND dispune de func�ia Quick Security Setup, ideal� pentru stabilirea unei conexiuni criptate WPA pentru a preveni intruziunile nedorite, odat� cu maximizarea resurselor de management. Nu numai c� aceast� metod� este mai rapid� decât realizarea set�rilor uzuale de securitate, dar este mai convenabil� �i nu presupune memorarea unei parole!

Anten� deta�abil�

TL-WN751ND este echipat cu anten� extern� deta�abil�, care poate fi rotit� �i ajustat� pe diferite direc�ii pentru func�ionarea optim� în diferite medii de operare, oferind performan�e superioare comparativ cu o anten� intern�. Pentru aplica�ii complexe, antena poate fi înlocuit� cu diverse alte modele pentru a permite o flexibilitate crescut� �i o acoperire mai larg�.

Caracteristici
  • Vitez� de pân� la 150Mbps, ideal� pentru streaming video, jocuri online �i apeluri Internet
  • Suport� func�ia QSS, compatibilitate cu WPS pentru securizare wireless f�r� griji
  • Suport� WEP 64/128, WPA /WPA2/WPA-PSK/WPA2-PSK(TKIP/AES), suport� IEEE 802.1X
  • Anten� deta�abil�, permite o aliniere mai bun� �i ofer� posibilit��i de upgrade la antene mai puternice
  • Utilitarul furnizat permite instalarea rapid� �i f�r� efort
  • Compatibilitate deplin� cu dispozitivele 802.11n/b/g
  • Suport� modurile Ad-Hoc �i infrastructur�
  • Suport� Windows Vista 32/64bi�i, XP 32/64bi�i, Windows 2000
 
SPECIFICATII
 
CARACTERISTICI HARDWARE
Interfa��
PCI 32bi�i
Anten�
Mini, omni, 2dBi
Dimensiuni (l x L x H)
120.8 x 78.5 x 21.5 mm
CARACTERISTICI WIRELESS
Standarde wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Frecven��
2.4-2.4835GHz
Rat� de semnal
11n: pân� la 150Mbps
11g: pân� la 54Mbps
11b: pân� la 11Mbps
Putere transmisie wireless
18dBm(EIRP MAX)
Sensibilitate receptor 130M: -68dBm@10% PER
108M: -68dBm@10% PER
54M: -68dBm@10% PER
11M: -85dBm@8% PER
6M: -88dBm@10% PER
1M: -90dBm@8% PER
Moduri wireless Mod Ad-Hoc / Infrastructure
Securitate wireless WEP 64/128 bi�i
WPA/WPA2, WPA-PSK/WPA2-PSK (TKIP/AES)
Tehnologie de modula�ie OFDM/CCK/16-QAM/64-QAM
ALTELE
 Certific�ri CE, FCC, RoHS
 Con�inut pachet Adaptor wireless
CD resurse
Ghid Instalare Rapid�
Cerin�e de sistem Windows 7 (32/64bi�i), Windows Vista (32/64bi�i), Windows XP (32/64bi�i), Windows 2000
Mediu Temperatur� de operare: 0°C~40°C
Temperatur� depozitare: -40°C~70°C
Umiditate de operare: 10%~90% f�r� condensare
Umiditate depozitare: 5%~90% f�r� condensare
 
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept