Curs valutar


1 EURO = 4.7216 RON  
1 USD = 4.2706 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc


 » Placi de retea wireless, Placi PCMCIA wireless, USB wireless

Adaptor PCI Wireless N 150Mbps TP-Link TL-WN751ND

Placa retea, Adaptor PCI Wireless N 150Mbps, antena detasabila

TP-Link - TL-WN751ND

Adaptor wireless N 150Mbps PCI, Atheros, 1T1R, 2.4GHz, 802.11n/g/b, 1 antena detasabila

Pret vechi fara TVA :
49,00 RON

Pret nou fara TVA :
30,00 RON

Pret nou cu TVA :
35,70 RON

Disponibilitate :

TP-Link TL-WN751ND - Adaptor PCI Wireless N 150Mbps
Caracteristici esențiale:
  • Rate de transfer wireless de până la 150Mbps
  • Dispune de interfață PCI 32-biți
  • Opțiuni de securitate avansată cu posibilități de criptare WPA/WPA2
  • Administrare simplă prin intermediul utilitarului inclus

Ce face acest produs

TP-LINK TL-WN751ND este conceput pentru a oferi performanțe wireless complete pentru întreaga rețea, de la servere și backbone la switch-uri și chiar până la computere desktop prin intermediul interfeței PCI. Adaptorul wireless N PCI TL-WN751ND dispune de compatibilitate extinsă, putând fi conectat în orice slot standard PCI 32-biți. Comparativ cu plăcile de rețea PCI standard, acesta oferă o lățime de bandă ridicată, stabilitate și funcționalitate crescută, oferind utilizatorilor posibilitatea de a beneficia de o conexiune rapidă și avansată pentru download, apeluri pe internet și streaming video.

Wireless N - viteză și acoperire

Respectând standardul IEEE 802.11n, TL-WN751ND poate stabili cu ușurință o rețea wireless și poate atinge o viteză de transmisie și o arie de acoperire de 9 ori, și respectiv de 4 ori, mai mare decât produsele 11g convenționale. Comparativ cu produsele 54M convenționale, TL-WN751ND asigură performanțe ridicate, oferind utilizatorilor o experiență excelentă de navigare pe Internet, pentru partajarea resurselor și vizualizarea clipurilor video.

Criptare WPA / WPA2 - securitate avansată

În ceea ce privește securitatea conexiunii WI-FI, criptarea WEP nu mai este considerată cea mai puternică și sigură metodă de protecție împotriva intruziunilor exterioare. TL-WN751ND oferă posibilități de criptare WPA/WPA2 dezvoltate de grupul WI-FI Alliance, oferind o protecție eficientă a rețelei wireless împotriva amenințărilor din exterior.

Securizare wireless rapidă

Compatibil cu WPS (WI-FI Protected Setup™), TL-WN751ND dispune de funcția Quick Security Setup, ideală pentru stabilirea unei conexiuni criptate WPA pentru a preveni intruziunile nedorite, odată cu maximizarea resurselor de management. Nu numai că această metodă este mai rapidă decât realizarea setărilor uzuale de securitate, dar este mai convenabilă și nu presupune memorarea unei parole!

Antenă detașabilă

TL-WN751ND este echipat cu antenă externă detașabilă, care poate fi rotită și ajustată pe diferite direcții pentru funcționarea optimă în diferite medii de operare, oferind performanțe superioare comparativ cu o antenă internă. Pentru aplicații complexe, antena poate fi înlocuită cu diverse alte modele pentru a permite o flexibilitate crescută și o acoperire mai largă.

  • Viteză de până la 150Mbps, ideală pentru streaming video, jocuri online și apeluri Internet
  • Suportă funcția QSS, compatibilitate cu WPS pentru securizare wireless fără griji
  • Suportă WEP 64/128, WPA /WPA2/WPA-PSK/WPA2-PSK(TKIP/AES), suportă IEEE 802.1X
  • Antenă detașabilă, permite o aliniere mai bună și oferă posibilități de upgrade la antene mai puternice
  • Utilitarul furnizat permite instalarea rapidă și fără efort
  • Compatibilitate deplină cu dispozitivele 802.11n/b/g
  • Suportă modurile Ad-Hoc și infrastructură
  • Suportă Windows Vista 32/64biți, XP 32/64biți, Windows 2000
PCI 32biți
Mini, omni, 2dBi
Dimensiuni (l x L x H)
120.8 x 78.5 x 21.5 mm
Standarde wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Rată de semnal
11n: până la 150Mbps
11g: până la 54Mbps
11b: până la 11Mbps
Putere transmisie wireless
Sensibilitate receptor 130M: -68dBm@10% PER
108M: -68dBm@10% PER
54M: -68dBm@10% PER
11M: -85dBm@8% PER
6M: -88dBm@10% PER
1M: -90dBm@8% PER
Moduri wireless Mod Ad-Hoc / Infrastructure
Securitate wireless WEP 64/128 biți
Tehnologie de modulație OFDM/CCK/16-QAM/64-QAM
 Certificări CE, FCC, RoHS
 Conținut pachet Adaptor wireless
CD resurse
Ghid Instalare Rapidă
Cerințe de sistem Windows 7 (32/64biți), Windows Vista (32/64biți), Windows XP (32/64biți), Windows 2000
Mediu Temperatură de operare: 0°C~40°C
Temperatură depozitare: -40°C~70°C
Umiditate de operare: 10%~90% fără condensare
Umiditate depozitare: 5%~90% fără condensare
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a Ăźmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. ContinuĂąnd să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor Ăźn conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept