Curs valutar


1 EURO = 4.7524 RON  
1 USD = 4.3164 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Aparate de sudura fibra optica


Palm OTDR - Aparat de masura fibra optica

CETC - AV6416

AV6416 palm OTDR is the newest instrument designed for testing FTTx network. It´s mainly used to measure the physical characteristics of optical fiber under test, such as the length,the transmission loss and the splice loss etc.. It can also locate the faults or breaks of optical fiber. It´s widely applied in the manufacture, construction and maintenance in optical fiber communication system.
AV6416 palm OTDR has the most advanced technology of double-color & material integrative mould,which is novel and beautiful in appearance.AV6416 offers three wavelengths and VLF in one handheld unit, especially for testing passive optical network (PON) in FTTx. In addition, it´s equipped with comfortable gallus for carrying conveniently.
Pret fara TVA:
13,905.52 RON

Pret cu TVA :
16.547,57 RON

Disponibilitate :
La comanda



6416 Handheld Optical Time-Domain Reflectometer (6416 OTDR) is a test instrument designed for FTTx, which is mainly used to measure the physical characteristics of optical fiber & cables, including length, transmission loss and splice loss etc.. It can also accurately locate the event point and fault point along the optical fiber. 6416 OTDR is widely applied to the engineering construction, maintenance test, and urgent repairing of optical fiber communication system, as well as the R&D, manufacturing, and test of optical fiber & cables. 6416 OTDR adopts the most advanced technology of double color and two materials integrative mold design process, which makes it novel and beautiful in appearance, strong and firm in structure. With antireflection LCD display, the operation interface is quite clear even in field environment. Two power supply modes are ailable. With the large capacity lithium battery, the instrument can work more than 10 hours. It has two types of USB interfaces, which can connect to the U disk, or can communicate with PC through USB cable. In addition, it provides comfortable straps for convenient carrying.



Ultra-short event dead zone

6416 OTDRhas ultra-short event dead zone, which is especially suitable to test the short optical fiber line and optical fiber jumper.



High-speed automatic test

With the automatic measurement function of 6416 OTDR, users can easily conduct the test with no need to know about the operation details. The steps are simple: just connect the fiber, and press【Start】, then the instrument will set the optimum test conditions and display accurate test results, such as testing curve and event table. 




High-speed curve analysis

6416can rapidly and accurately search and locate the events or fault points in the testing curve, and further list all event information in the form of event table, which is very useful for maintenance personnel, because on the one hand, it enhances the test efficiency, and on the other hand, there is no need for them to know about the complicated background knowledge. 



Powerful File Management

6416 OTDR offers powerful file management function. It can not only se, browse or delete files inside the instrument or from the USB disk, but also connect to the laser printer or inkjet printer (based on PCL language) to print out the test report.

In addition, with SyncActive software, the OTDR can communicate with PC via USB cable in high-speed.



Convenient VFL  

VFL can rapidly and conveniently find the breaking point or remarkable loss point along the short-distance optical fiber line, so that the maintenance personnel can take steps in short time.  




Automatic detection & alarm on the communication light signal

6416 OTDR is capable of automatically detecting the communication light signal in the fiber under test once the fiber is connected to the optical interface. If there is light signal, it will alarm, so to provide protection for the instrument in time.





6416 OTDR is mainly used to test FTTx network, it provides a low cost test solution for users and offersthree test modes: manual (real-time, eraging), automatic, and dead zone.

Manual test mode: Manual mode is suitable for skilled operators who are familiar with the instrument, so that to get more accurate test result. In manual test mode, real-time mode or eraging mode can be selected based on user demand.

Real-time test can rapidly detect the dynamic changes of the optical fiber. It is applicable to real-time monitor or observe the optical fiber connection process and effect.

eraging test mode can maximumly suppress the noise in the testing curve, so to get a more accurate result. Under eraging test mode, the more eraging times, the better suppression of the noise, but the longer time it takes. So, in practice, the eraging times should be set properly according to necessity.

Automatic test mode: Under this mode, the instrument can automatically set the optimized test conditions, and give out the test result. There is no need for the operators to know about the complicated background knowledge and the operation details. To enhance the automatic test efficiency, the eraging times can be increased properly, though it will prolong the test time.

Dead zone test mode: This mode is suitable to test the optical fiber with short distance, for example, to test the jumper length of the optical fiber. Under this mode, to get the best result, the reflection loss (or called return loss) of the fiber terminal is required to be larger than 40dB.



 Dynamic  Range1 

 See Details  in “ Technical specifications of all   6416 OTDR Modules ” Chart 

 Distance Accuracy 

 ±(1m+Sample   Spacing+0.003%×Distance) (not   including Refractive Error) 

 Event Dead  Zone2 


 Distance Resolution 

 0.25,  0.5, 1, 2, 4, 8, 16m 

 Distance  Range 

 0.5, 1,  2, 4, 8, 16, 32, 64, 128, 256km; 

 Pulse Widths 

 10, 30,  80, 160, 320, 640, 1280, 5120, 10240ns 

 Loss Threshold 


 Sample Points 




 Storage Capacity 


 IOR Setting 



 320×240,  3.5 Inch Color LCD, touch   screen 

 Interface  Languages 

 Simplified  Chinese/ English 

 VFL Function 

 650nm±20nm,  2mW (typical); CW/1Hz 

 Optical  Connector 

 FC/UPC  (standard. Options: SC, LC, ST) 


 USB,  Min-USB 

 Power Supply 

 AC/DC  Adapter: Input: AC 100V~240V,    50/60Hz, 1.5A Output:  DC  15V~20V  (2A) Build-in    lithium-ion Battery: 7.4V, 4400mAh, service time: 10 hours (Constant    Temperature)3 


 W×H×D =    100mm×210mm×60mm 


 About  1kg 

 Environmental  Suitability 

 Operating  Temperature: 0℃~40℃ (battery charging: 5℃~40℃) Storage  Temperature: -40℃~70℃ (battery not included) Relative Humidity: 5%~95%, Non-condensing. 


1. Environment temperature: 23℃±2℃, max. pulse width, erage times>300, SNR=1.

2. Dead zone test mode (distance 4km, pulse width 10ns, attenuation 10dB), fiber end reflection loss≥40dB, typical value.

3. Low brightness, no test.


Standard Modules: The available modules of 6416 OTDR are as follows:

Technical Specifications  of 6416 Modules

Ordering No.

Operating Welength

Fiber Type

Dynamic Range 

Modules with Single Wavelength














1625nm (Build-in filter)








1650nm (Build-in filter)











Modules with Two Wavelengths


1310 / 1550nm




1550 / 1625nm




1550 / 1625nm (Build-in filter)




1550 / 1650nm




1550 / 1650nm(Build-in filter)




1310 / 1550nm




1310 / 1550nm



Modules with Three Wavelengths


1310 / 1550/ 1625nm


28 / 26 / 26


1310 / 1550 / 1625nm (Build-in  filter)


28 / 26 / 25


1310 / 1550 / 1650 nm


28 / 26 / 26


1310 / 1550 / 1650 nm (Build-in  filter)


28 / 26 / 25


1310 / 1490 / 1550nm


28 / 24/ 26

Note:  1. One and only one module of OTDR must be selected.            

            2. VFL function is not ailable.



Main Unit

No. Name Description
6416 OTDR  


Hardware Options

No. Name Description
6416-001 USB Disk To save waveform file
6416-002 Printer HP Laser Jet P2015d or HP Laser Jet 1022 to Print Testing Curves
6416-003 USB Cable Communicating with PC
6416-004 Standby Battery Pack Standby battery specially for 6416
6416-005 SC、LC、 ST Adapters Provide multiple optical fiber adapters
6416-006 Engineering Plastic Bag Specially for instruments
6416-1101 1310nm SMF28
6416-1102 1550nm SMF26
6416-1103 1625nm SMF26
6416-1104 1625nm SMF26
6416-1105 1650nm SMF26
6416-1106 1650nm (Build-in filter) SMF26
6416-1107 1490nm SMF24
6416-1108 1383nm (Build-in filter) SMF26
6416-2101 1490nm SMF28/26
6416-2102 1383nm SMF28/26
6416-21031 1310 / 1550nm SMF26/26
6416-2104 1550 / 1625nm SMF26/26
6416-21052 1550 / 1625nm (Build-in filter) SMF26/26
6416-2106 1550 / 1650nm SMF26/26
6416-2107 1550 / 1650nm(Build-in filter) SMF32/30
6416-3101 1310 / 1550nm SMF37/35
6416-3102 1310 / 1550nm SMF28 / 26 / 26
6416-3103 1310 / 1550/ 1625nm SMF28 / 26 / 25
6416-3104 1310 / 1550 / 1625nm (Build-in filter) SMF28 / 26 / 26
6416-3105 1310 / 1550 / 1650 nm SMF28 / 26 / 25


Standard Package

No. Name Description
1 Power Supply Power cord
2 Certificate of Conformity power adapter:Input voltage 100~240V,50~60Hz,2.0A Output voltage 19V
3 User Manual Output current 3.42A
4 CD (Simulation & Analysis Software)  
5 Special Soft Bag for Instruments  
6 Straps Especially for Instruments  


Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept