Curs valutar


1 EURO = 4.7792 RON  
1 USD = 4.2976 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


Accesorii GPS

Receptor Bluetooth GPS West Studio BT-74RReceptor Bluetooth GPS West Studio - BT-74R

Receptor GPS Bluetooth, chipset Fujitsu, 32 Ch., -157 dBm, Acumulator Li-Ion 1100 mA, operare 13H

Pret : 239.73 RON
*) Pretul nu contine TVA
cuTVA: 285.28 RON
Disponibilitate : Sunati
Receptor Bluetooth GPS West Studio BT-55Receptor Bluetooth GPS West Studio - BT-55

Receptor GPS Bluetooth, chipset Nemerix, 16 Ch., -152 dBm, Acumulator Li-Ion 710 mA, operare 22H

Pret : 199.36 RON
*) Pretul nu contine TVA
cuTVA: 237.24 RON
Disponibilitate : Sunati
Receptor Bluetooth GPS West Studio BT-74SReceptor Bluetooth GPS West Studio - BT-74S

Receptor GPS Bluetooth, Sirf Star III chipset, 20 Ch., -159 dBm, Acumulator Li-Ion 1100 mA, operare 15H

Pret : 248.10 RON
*) Pretul nu contine TVA
cuTVA: 295.24 RON
Disponibilitate : Sunati
Casca bluetooth si kit auto West Studio - BH-500

Kit 2 in 1 - casca bluetooth si kit auto pentru telefoane mobile

Pret : 139.05 RON
*) Pretul nu contine TVA
cuTVA: 165.47 RON
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept