Curs valutar


1 EURO = 4.7231 RON  
1 USD = 4.2103 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20km


 » Osciloscoape digitale

Osciloscop digital Atten ADS2202CA

Osciloscop digital

Atten - ADS2202CA

Osciloscop digital de laborator, 200MHz, 1GS/s, afisaj color LCD, interfata USB

Pret vechi fara TVA :
3.635,00 RON

Pret nou fara TVA :
2.900,00 RON

Pret nou cu TVA :
3.451,00 RON

Disponibilitate :

Waveform Recorder Function

Using this function, Users can continue record data of their need signals as the form of frame. Waveform recorder can record input waveform from CH1 and CH2, with maximum record length of 1000 frames. This record behavior can also be activated by the pass/fail test output, which makes this function especially useful to capture abnormal signals in long term without keeping an eye watching it.

Powerful Storage Function

ADS2000 series can save two reference waveforms, twenty captured waveforms and twenty setups by bigger capability hardware memorizer, providing most storage options in the same level digital storage oscilloscopes. Two reference waveforms can be displayed simultaneously, so users can compare them with other waveforms expediently. 

Auto Measure Function

ADS2000 series can auto measure thirty two parameters, which is most in the same level digital oscilloscopes. Auto measure function can eliminate user error consumedly, and users will measure parameters what they need faster and more accurately using it. ADS2000 series also have a all measurement function that displays all the waveform parameters on the screen according to measure kinds, and users can ready measure parameters value expediently. So ADS2000 series are your most perfect measure tools in current market.

EasyhuntingTM Patent Technology

All ADS2000 series products employ EasyHuntingTM patented technology when capturing waveforms. EasyHuntingTM was invented patented by our own engineers and employs a unique hardware design and software algorithm. In essence, it enables our oscilloscopes to capture waveforms with higher precision than other competitive products globally. Comparative testing proved that the ADS2000 series were able to capture and display waveforms more steady and accurate than other products of the same specifications. EasyHuntingTM takes full advantage of hardware capabilities to give the user the ability to observe fast changing signals with less sampling jitter.

Sampling Rate Enhancement

The real time sampling rate up to 1GSa/s or 500MSa/s is available in the ADS2000 series of digital storage oscilloscopes and the equivalent sampling rate goes up to 50GSa/s, which represent the highest level presently available worldwide in comparable digital storage oscilloscopes. Real time and Equivalent time sampling are selectable in the ADS2000 series products, which not only satisfy with market need that capture variety and complex signals but make users observe periodicity signals more accurate. 

Digital Filter Function

ADS2000 series provide a digital filter function, and users can use it setting upper limit and lower limit of frequency to reduce signal noise and filter error signal. So they can observe their interested signals distinctly, which will advance users’ work efficiency consumedly.  

USB Flash Drive Storage

With the extensive use of the USB flash drive, USB flash drive storage function is one of the absolutely necessarily functions in mainstream digital storage oscilloscopes. USB flash drive storage function operation of ADS2000 series is more simple and convenient comparing with other brand digital oscilloscopes. Users can save the oscilloscope settings, waveform data, or screen images to the USB flash drive though the Save/Recall menu convenient for using them in future.

- See more at: 

Short review ATTEN ADS2202CA. Bandwidth of 200 MHz and Samplig rate of 1 GS/s are the guarantees of flawless display of high frequency, complex and single waveforms

ATTEN ADS2202CA digital oscilloscope is a powerfool tool for setting up and testing of circuits and waveform logical connections.

Bandwidth of 200 MHz and Samplig rate of 1 GS/s are the guarantees of flawless display of high frequency, complex and single waveforms.

ATTEN ADS2202CA meets all the requirements to be a modern budget oscilloscope. 32 built-in automatic measurement functions, such as waveform timegap measurement, waveform phases etc. allow uuser to understand and analyse incoming waveforms. Additional functions include function of access control, user-definre digital filters and more allow faster and easier calibration of various radio devices.

User-friendly interface. Support of 11 languages.

Built-in USB-host allows connecting external data storage devices. USB-slot on the rear panel allows direct connection of the printer. EasyScope Computer Software System allows remote control through the virtual panel and presents easy way of caving waveform data as arrays or images.


  • 2-channel. Bandwidth - 200 MHz
  • Compact size saves space and allows easy outdoor measurements.
  • Color 5.7" LCD screen, 320x234px Clear and stable waveform data display.
  • Sampling rate: 1 GS/s
  • Equivalent sampling rate: 50 GS/s
  • Memory capacity: 4K.
  • Advanced start functions: frontal, video, pulse width, pulse delay.
  • Built-in USB-host, USB-slot for PC connection, GPIB-interface.
  • Digital filter and recorder functions
  • Good/bad mode
  • 32 automatic measurements
  • Pointer measurements mode: manual, tracking, automatic
  • 5 mathematic functions: add, subtract, multiply, divide, FFT (for 1K memjry length), digital filters (HF, LF, linear, elimination)
  • Frame waveform registering mode (up to 2500 frames, recording and replaying)


Model ADS2202CA
Channel quantity: 2-channels
Bandwidth 200 MHz
Samplig rate 1 GS/s
Equivalent sampling rate 50 GS/s
Memory 4k
Building-up time 1.8ns
Input impedance 1MOm, 13pF, 50Om
Horizontal sweep time: 2.5 ns/dgt - 50s/dgt
Display Color 5.7" LCD screen, 320x234px
Vertical sensitivity 2 mV/dgt - 5V/dgt. (1-2-5 sequence)
Vertical resolution 8 bit
A1 and A2 input mode DC, AC, ground
Maximum input voltage 300V (DC+AC max (1MOm input impedance 10X), 
5V (50Om input impedance, BNC)
Start modes frontal, video, pulse width, pulse delay, external synchonisation
Sweep start modes Auto, normal, single
Synchronisation sources

CH1, CH2, Ext, Ext/5, AC Line

Store/Recall Up to 20 waveforms and up to 20 control settings profiles. Bigger data storages may be connected via USB-slot on the device front panel.
Automatic measurements Vpp, Vamp, Vmax, Vmin, Vup, Vdn, Vavg, Vrms, Negative peak, Positive peak, frequency, period, building-up time, fall time, positive legth, negative length, positive load coefficient, negative load coefficient, delay.
Pointer measurements Modes manual, tracking, automatic
Mathematic functions Adding, subtracting, multiplying, dividing, FFT

Window: Hanning, Hamming, Blackman, Square

XY- modes Phase error ±3
Menu languages Simplified Chinese, Traditional Chinese, English, Arab, French, German, Russian, Spanish, Portuguese, Japanese, Korean
Power supply 100-240V, 40-440Hz CAT II. 50W max 50 W max.
Measurements 300x150x 290 mm
Weight 4.6 kg
USB-host Externa devices support
USB Direct PictBridge printing support; PC control
Accessories 10:1 Probes x2, EasyScope Computer Software System, Power Cord, User's Guide.
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept