Curs valutar

16-Oct-2019

1 EURO = 4.7524 RON  
1 USD = 4.3164 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

Noduri optice cu cale inversa inclusa, etanse pentru montare exterioara

 
  Descriere Pret
Nod optic miniatura de interior DIODA PIN SC/APCNod Optic cu laser 1mW pe cale inversa, iesire de putere nextraCOM - WR-8601RL

Nod optic miniatura de interior bidirectional, intrare optica -7+2dB / 1100-1600nm, conector SC/APC, iesire RF cale directa 85-860MHz / 95dB, intrare cale inversa 5-65MHz / 80-90dBm, iesire optica cale inversa laser FP 1mW / 1310nm, conector SC/PC, alimentare 220V

Pret vechi 427.72 RON
Pret nou
152.08 RON
*) Pretul nu contine TVA
cuTVA: 180.97 RON
Disponibilitate : Sunati
Nod Optic Maiwei MW2002(ORT)-1mWNod Optic Braun_Group - MW2002(ORT)-1mW

1290-1600nm, receptor optic Philips -7dBm, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 1mW, telealim 30-90VAC

Pret : 1,069.29 RON
*) Pretul nu contine TVA
cuTVA: 1,272.46 RON
Disponibilitate : Sunati
Nod Optic Maiwei MW2002(ORT)-2mWNod Optic Braun_Group - MW2002(ORT)-2mW

1290-1600nm, receptor optic Philips -7dBm, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 2mW, telealim 30-90VAC

Pret : 1,140.58 RON
*) Pretul nu contine TVA
cuTVA: 1,357.29 RON
Disponibilitate : Sunati
Nod Optic Maiwei MW2002(ORT)-2mW-PINNod Optic Braun_Group - MW2002(ORT)-2mW-PIN

1290-1600nm, receptor optic DIODA PIN, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 2mW, telealim 30-90VAC

Pret : 784.15 RON
*) Pretul nu contine TVA
cuTVA: 933.13 RON
Disponibilitate : Sunati
Nod Optic Maiwei MW2002(ORT)-1mW-PINNod Optic Braun_Group - MW2002(ORT)-1mW-PIN

1290-1600nm, receptor optic DIODA PIN, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 1mW, telealim 30-90VAC

Pret : 689.10 RON
*) Pretul nu contine TVA
cuTVA: 820.03 RON
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept