Curs valutar

23-Apr-2019

1 EURO = 4.7581 RON  
1 USD = 4.2268 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality

ANPC

Noduri optice cu cale inversa inclusa, etanse pentru montare exterioara

 
  Descriere Pret
Nod optic miniatura de interior DIODA PIN SC/APCNod Optic cu laser 1mW pe cale inversa, iesire de putere nextraCOM - WR-8601RL

Nod optic miniatura de interior bidirectional, intrare optica -7+2dB / 1100-1600nm, conector SC/APC, iesire RF cale directa 85-860MHz / 95dB, intrare cale inversa 5-65MHz / 80-90dBm, iesire optica cale inversa laser FP 1mW / 1310nm, conector SC/PC, alimentare 220V

Pret vechi: 428.23 RON
Pret nou:
152.26 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
Nod Optic Maiwei MW2002(ORT)-1mWNod Optic Braun_Group - MW2002(ORT)-1mW

1290-1600nm, receptor optic Philips -7dBm, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 1mW, telealim 30-90VAC

Pret : 1,070.57 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Nod Optic Maiwei MW2002(ORT)-2mW-PINNod Optic Braun_Group - MW2002(ORT)-2mW-PIN

1290-1600nm, receptor optic DIODA PIN, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 2mW, telealim 30-90VAC

Pret : 785.09 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Nod Optic Maiwei MW2002(ORT)-2mWNod Optic Braun_Group - MW2002(ORT)-2mW

1290-1600nm, receptor optic Philips -7dBm, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 2mW, telealim 30-90VAC

Pret : 1,141.94 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Nod Optic Maiwei MW2002(ORT)-1mW-PINNod Optic Braun_Group - MW2002(ORT)-1mW-PIN

1290-1600nm, receptor optic DIODA PIN, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 1mW, telealim 30-90VAC

Pret : 689.92 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept