Curs valutar


1 EURO = 4.7345 RON  
1 USD = 4.2201 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic


 » Noduri optice cu cale inversa inclusa, etanse pentru montare exterioara

Nod Optic Maiwei MW2002(ORT)-1mW-PIN

Nod Optic

Braun_Group - MW2002(ORT)-1mW-PIN

1290-1600nm, receptor optic DIODA PIN, SC/APC, 2 ies RF(1 hibrid), 45-860MHz, 102dBmV, cale inversa 5-200MHz, laser FP 1mW, telealim 30-90VAC

Pret fara TVA:
686.50 RON

Pret cu TVA :
816,94 RON

Disponibilitate :

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept