Curs valutar


1 EURO = 4.8393 RON  
1 USD = 4.2695 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


 » NVR-uri

8-CH Network Video Recorder

NVR 8 canale

Planet - NVR-810

NVR 8 Canale

Alte imagini:
8-CH Network Video Recorder8-CH Network Video Recorder Application
Pret fara TVA:
2,602.94 RON

Pret cu TVA :
3.097,50 RON

Disponibilitate :
La comanda

NVR-NVR-810 8-CH Network Video Recorder
PLANET introduces new models of Network Video Recorder (NVR) series, NVR-810, that are perfectly designed for intelligent IP surveillance system. Users can just turn on the cameras and the NVR to easily protect their life and properties under the IP networks. The recorded video files can be saved in the NVR and no need of using additional PC for files storage, which brings users a secure surveillance system with lower total cost.

Up to 8 IP cameras can be connected to the NVR-810 via a connected IP network. With the NVR-810, users can view remote surveillance in real time and play back recorded videos via the web browser or the bundled CMS software. The NVR-810 not only support PLANET IP cameras but also compatible with most of major IP camera brands in the market. Furthermore, the NVR-810 can automatically search and find the available cameras in the network so it greatly reduces users’ effort when setting up the system.

Not just for small scale applications such as retail stores and SMB, the NVR system is expandable for multi-sites management with the bundled CMS software. For instance, the CMS software in the NVR-810 can manage up to 8 units of NVR at the same time; that means, there shall be 128 channels of IP cameras being viewed simultaneously. With multi-monitor and E-Map function, the NVR can help the administrators to monitor the surveillance system more efficiently and effectively.

The NVR-810 feature smart setup wizard program to help users easily complete the device installation. It supports web-based management interface for the administrators to remotely manage the device via web browser without any concern. It also provides the management utility for central management of the surveillance network. This state-of-the-art and powerful software / hardware in one design is considerable to fit in various network environments.
Key features
Main Function
• Simultaneous Recording and Live Video Streams
• Supports M-JPEG / MPEG-4 / H.264 compressions
• Mobile Devices Remote Monitoring (iNVR Viewer)
• Auto Configuration for PLANET IP Camera
• Video resolution up to 5 Mega-Pixel (2560 * 1920)
• Support up to 480fps @ Mega-Pixel (H.264)
• Easy access with PLANTE Dynamic DNS
• Manual or Schedule Recording of 8 IP Cameras simultaneously

• Up to 8, max. 128 (NVR-810) channels with the management software
• Video recycle function makes the video recording in 7/24
• Web-Based and management utility for easy configuration
• 2-Way Audio function
• E-Map interface in web and utility configuration
• Auto discover by management software
• Smart IP camera search
• Exports record video file to AVI format
• Multiple Languages support
• Supports mobile phone remote view with WinCE 6.1, Android, Symbian S60, iPhone,
 Blackberry 4.6

• Gigabit Ethernet port
• LED indicators to display the status of connected IP cameras
• Built-in 8 x DI, 4 x DO for Event Management
• Supports external UPS (USB)
Compression MJPEG / MPEG-4 / H.264
Resolution 5 MP / HD / Mega-Pixel / FD1 / CIF / QCIF
Max. Frame Rate 240 fps (1920 x 1080, H.264)
Display Mode Live View / Playback / Full Screen
PTZ Support Virtual PTZ Panel / Auto Pan / Preset Point / Preset Sequence / Digital PTZ
Sequence Mode Sequence All
Manually selected cameras in 1/4 split view with configurable timer
Snapshot 3 continuous snapshots in JPEG format
E-Map Motion Detected Event Display on E-Map
Google Map
Recording Mode Manual, Schedule, Event, Continuous
Video Input 8 Channels IP Cameras
Ethernet 1 x RJ-45, 10/100/1000Base-T
USB Interface 1 x USB 2.0 for backup device and firmware upgrade
Storage Device 2 x 3.5" SATA II Hard Disk Connectors
Button Power, Reset, Buzzer
LED Display 1 x Power
1 x Status
1 x LAN
2 x HDD
1 x Alarm
8 x IP Camera
Network and Configuration
Network File Protocol Microsoft Networks (CIFS/SMB), Internet (HTTP), FTP
Management Web-Based Administration
Network Time Protocol
Multiple Users Account
E-mail Notification
System Log
Firmware Upgrade
User Interface Web Browser
CMS Utility
Power 100~240V AC, 1.4A / Max. 50/60Hz
Consumption 90W
Operating Temperature 0~45 Degree C
Storage Temperature -40~70 Degree C
Humidity 0~90% (non-condition)
Weight 2.89 kg
Dimension (W x D x H) 170 x 215 x 125 mm
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept