Curs valutar

16-Oct-2019

1 EURO = 4.7524 RON  
1 USD = 4.3164 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

 » NVR-uri



NVR-4316Z

NVR 16 Camere IP HD

Braun Group - NVR-4316Z

NVR 16 canale , 8ch 1080P/13ch 960P/16ch 720P realtime recording, 2ch 1080P/4ch 960P/4ch 720P realtime  Playback, Support VGA, PTZ,






Pret vechi fara TVA :
824,07 RON


Pret nou fara TVA :
684,35 RON

Pret nou cu TVA :
814,37 RON

Disponibilitate :
Sunati

Optional:

HDD-1TB - Seagate Surveillance SV-35(ST1000VX000) 3.5", SATA III 600, 64MB Cache

HDD-2TB - Seagate Surveillance SV-35(ST2000VX000) 3.5", SATA III 600, 64MB Cache

 

FEATURES

1. Abandon all kinds of complicated setting, through professional cloud services , easy to achieve variety

of network penetration,  one step to achieve remote monitoring.

2. Upgrade compression algorithm to H.264 Main Profile, advanced space-time filtering technology enables

stream representing a decrease of more than 30%

3.Possess both Main and extra streams encode codes simultaneously. Main stream for local storage and

extra streams for real-time network transmission, bandwidth bottleneck problem easily solved.

4. Support various types of mobile monitoring (iPhone, Android)
5. Support TV, VGA and HDMI output simultaneously, real HD resolution output leading technology trends
6.Similar WINDOWS operating style, powerful mouse right-click menu function, so surprisingly easy to get started

7.Powerful network services (support DHCP / ADSL, PPPOE, DDNS, UDP, TCP / IP, etc.), perfect (WEB, client),

easy to achieve interoperability

8.Supported Web browser (Internet 32-bit browser, 360, Sogou, etc.)

9.Support DDNS domain name service, such as: 3322 (Greek network), dyndns, oray (peanut shells), myq-see,

NO-IP, make monitoring becomes easy and enjoyable.

10. Support alarm triggered video and photos and upload to the specified EMAIL. Support for 10 seconds pre-record

function, not miss any suspicious screen.

11.Independent channel switching, each user has a separate operation screen.
11. screen preview, recording, playback, backup, network and mobile terminal operating simultaneously.
12. 2 USB2.0, can be operated via a USB mouse, backup, burning, upgrading.
13.Multi-lingual, multi-language easily interchangeable, breaking boundaries.
14. Automatically restored to working condition before power
SPECIFICATIONS
Model Model NO. 16 Channel H.264 NVR
NVR-4316Z
System Main CPU High performance embedded microprocessor HI3520A
Operation system Embedded LINUX operating system
System resource Pentaplex function: Live, recording, playback, backup& remote access and usb backup
Interface Play interface 16-bit true color graphical menu interface, support mouse, remote control, key operation
Multi language YES, support 14 different kinds of language
Picture show 1/4/8/9/16/32 disply
Video Video standard H.264(Main Profile)
Pictuure coding Monitor:D1; VGA & HDMI: (1920*1080,1280*1024,1024*768)
Monitor quality 1080P /960P /720P
Coding ability 8ch 1080P /13ch 960P /16ch 720P
Decoding ability 4ch 1080P /4ch 960P /4ch 720P
Audio Audio compression G.711A
Video and playback Recording method manual >alarm >motion detect>timing
Snapshot function YES
Local playback 4ch 1080P /4ch 960P /4ch 720P
Video search time calendar event channel 
Storage and backup Space use video   720P:10G~42G/day *channel ,1080P:20G~80G/day *channel ,audio  691.2M/day * channel 
Vidoe storage HDDNetwork
Backup method network backupUSB HDDU disk(FAT32 format)
Port Video input 16ch IP Camera
Video output 1ch BNC(1.0Vp-p,75Ω), 1ch VGA,1ch HDMI
Audio input ————
Audio output 1ch RCA (200-3000mV,5KΩ) 
Alarm input NO
Alarm ouoput  
Internet Port 1RJ45 10M/100M/1000M ethernet
Control Port 1RS485 interface,support more than 5 different kinds of PTZ protocol
USB Port 2 USB 2.0 interface
HDD Port 2SATA,(each max support 2TB)
Wireless port ————
User User grade Admin
User authorization different user can set different promission(the detail can refer to user manual )
Password protection YES
Remote access independent operation YES
Download playback YES
Alarm recording YES
Monitoring software Free CMS,one page can support 64 channel ,max connect 255 sets DVR
Browser Internatie32360sougou
Online Audio YES
Online User max 10
Mobile monitoring YES (support  iPad, iPhone,Android;iPad, iPhone, Andriod remote playback)
Internet protocol DHCP/ADSLPPPOE SMTPTCP / IPDDNSwireless dialWIFIP2P
Alarm Motion detect YES
Alarm methods  E-Mail
Pre-alarm recording YES
Video Lost video loss detection alarm
Other IR remote Available remote control DVR and PTZ remote control (IR receiver has built-in)
Cooling fan YES
Picture tour YES
Power adapter DC 12V /5A
Work consumption <10W(not including HDD)
Working enviro 0 ~ +55
size 325mm(L)* 245mm(W)* 52mm(H)
automatic recovery System auto recovery after power failure

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept