Curs valutar

28-Feb-2020

1 EURO = 4.8068 RON  
1 USD = 4.3926 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9

ANPC

 » Receptoare optice fara cale inversa de interior FTTH, FTTB



2

Minireceptor optic FTTH cu iesire GPON/GEPON echipat cu filtru WDM

nextraCOM - OR1075MB-WD

Receptor special proiectat pentru arhitectura OLT gigabit GPON /GEPON pentru ethernet/ internet impreuna cu semnal CATV pe o singura fibra single mode (green SC/APC input).

Minireceptor optic FTTH de interior cu filtru WDM pe intrare, intrare TV 1550nm -10+0dBm + trecere pentru Ethernet PON 1310/1490nm, conectori optici SC/APC, SC/PC, iesire RF>78dB la intrare -6dBm, temperatura de lucru -20+55 grade Celsius, consum <3W, dimensiuni 109x80x26mm
intrarea de banda larga CATV +PON pe conector SC/APC verde;
semnal CATV electric 5-1000Mhz pe iesirea F-coax;
iesire SC/PC albastru filtrata WDM pentru conectarea unui terminal ONU/ONT gigabit 1310/1490nm
sau a filtru PLC pentru multipli clienti PON
Este compatibil 100% cu orice terminal Gigabit EPON sau gigabit GPON recunoscut de OLT-ul din head end

Alte imagini:
OR1075MB-WD1
Pret fara TVA:
108.92 RON

Pret cu TVA :
129,62 RON

Disponibilitate :
Sunati

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept