Curs valutar


1 EURO = 4.8406 RON  
1 USD = 4.2942 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoegigabitcablu utpz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewayplugprizawirelessterouter wireless routerac routerraspberry piaudiovideocable4 contactrcajackamikounifiraspberry pi 2 model benergytkb4k3kmxsfpddmmountableantene 24ghz802.3atmeterraftsolo10gdoor phone720pcomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectriciraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbgftp5baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2cablu ftpab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascablutvcamewradvr4ch150mmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin bgftp6bgftp6pebgutp5bgutp6bgutp3bgutp5pebgftp5pebgutp6lszhbgutp6pebgutp5lszhbgsf/utp5lsnhbgftp5lszhbgftp6lszhbgf/ftp6abgf/ftp6apebgftp6alszh


 » Routere wireless


Mining Router gigabit AC1200, 5port gigabit, USB (4G/ FTPserver), Flash/Memory: 16MB SPI/ 256M DDR3 for mining, ipv6, ‎AP, Repeater, AP+WDS, WDS, client..

Netis - 360R

Un router de mare viteza cu Flash/Memory: 16MB SPI/ 256M DDR3 proiectat pentru   mining si multi- streaming de mare viteza, rezistent la stres si socuri de curent 
 - Cu un design superb si o acoperire extinsa, ruterul 360R Wireless AC1200  oferă următoarea generație Wi-fi la viteze Gigabit. Cu tehnologia simultană dual band Wi-fi, oferă viteze de  2.4 GHz 300Mbps + 5GHz 867Mbps și evită interferențele, asigurând viteze de top Wi-fi și conexiuni multistreaming 4k simultane. De asemenea 360R oferă conectivitate Gigabit prin cablu, cele mai bune pentru transferuri de fișiere de mare viteză și streaming HD media.
-> the largest memory DDDR3 for minning or multi- streaming; 
-->very stable to voltage fluctuations, this mode doesn't need UPS;
-> very long range compared to any other Ac1200 due to special antennas construction -4 antennas 6dB;

Alte imagini:

Pret vechi fara TVA :
164,58 RON

Pret nou fara TVA :
115,69 RON

Pret nou cu TVA :
137,67 RON

Disponibilitate :
In stoc


  • Metal Texture
  • 802.11AC standard of nex tgeneration WiFi
  • 2.4GHz 300Mbps & 5GHz 867Mbps simultaneous dual band
  • 4*5dBi high gain antennas for powerfu lwireless coverage
  • Multiple SSID providing up to 6additional wireless networks for visitors
  • Five Gigabit ports provide 10 times faster than conventiona lFast Ethernet connections
  • Quick setup, with built-in multilingua lwebmanagement page
  • USB2.0 port support Storage Sharing, FTP Server and MediaServer

Technical Specifications 

Standards IEEE802.11b/g/n2.4GHz;IEEE802.11a/n/ac5GHz
Signal Rate Upto300Mbps-2.4GHz;Upto867Mbps-5GHz
Frequency Range 2.4-2.4835GHz,5.180-5.825GHz
Transmit Power 20dBm(MAX)
Wireless Mode AP,WDS,AP+WDS,Repeater,Client,MultipleAP
Wireless Security 64/128-bit WEP,WPA-PSK/WPA2-PSK (TKIP/AES),SSID Broadcast Enable/Disable, Wireless MAC Filtering
Standard IEEE802.310Base-T,IEEE802.3u100Base-TX
Chipset RTL8197FB+RTL8812BRH+RTL8367RB
Interface 1*USB2.0
1 * 10/100/1000M Auto MDI/MDIX RJ45 WAN port
4 * 10/100/1000M Auto MDI/MDIX RJ45 LAN port
LED PWR,Internet,USB,2.4G,5G,WAN,LAN1~4
Button Default
Antenna 4*external 5dBi antennas,omni-directional
Power Supply DC 12V/1.5A
Dimensions(L x W x H ) 210*140*40
Weight Waga350g
Port Forwarding VirtualServers,PortTriggering,UPnP,DMZ,FTPPrivatePort
QoS WMM,Bandwidth Control
Access Control IP/MAC/Domain Filtering
VPN Pass-through PPTP,L2TP,IPSec
Others IPTV,DynamicDNS,Static Routing,WOL,Backup&Restore,Firmware Upgrade
Certification CE
Environment Operating Temperature:0-40Storage Temperature:-40-70Operating Humidity10%-90%
Storage Humidity: 5%-90%
Package 1* Device
1* 12V/1.5A power adapter
1* Ethernet Cable
1* Quick Installation Guide


Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept