Curs valutar


1 EURO = 4.7199 RON  
1 USD = 4.1541 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148v


Microfoane pentru statii radio

  Descriere Pret

Microfoane de baza

Microfon desktop statii radio Alinco EMS-14Microfon desktop statii radio Alinco - EMS-14

ALINCO, cu preamplificare

Pret : 245.43 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati

Microfoane pentru statii mobile

Microfon extern cu speaker pentru statii radio INTEK KME-H115Microfon extern cu speaker pentru statii radio INTEK - KME-H115

Microfon extern cu speaker pentru statii radio, tasta PTT, LED TX, jack casca, jack tip K

Pret : 54.28 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon statie Intek MC-S10Microfon statie Intek INTEK - MC-S10

Microfon pentru statii Intek, conector 4-pini, pentru Intek M-110 PLUS

Pret : 35.40 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon dinamic Intek pentru statii radioMicrofon statie Intek INTEK - MC-S90

Microfon dinamic Intek pentru statii radio, conector 6-pini, Taste UP/DN/LOCK, pentru: M-490 PLUS, M-790 PLUS, M-495 POWER, M-795 POWER

Pret : 55.22 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon dinamic pt statii radio CB INTEK MC-S79Microfon dinamic pt statii radio CB INTEK - MC-S79

Microfon dinamic pentru statii radio CB, conector 6-pini, taste: Up/Dn/LOCK. piesa de schimb originala pt M-799 PLUS

Pret : 50.50 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon dinamic pentru statiiMicrofon dinamic pentru statii Pihernz - PC 478

Microfon dinamic pentru statii radio, Impedanta: 500 Ohm, gain micro

Pret : 37.76 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon pentru statii radio mobile INTEK DMC-550-4PMicrofon pentru statii radio mobile INTEK - DMC-550-4P

Microfon dinamic statie CB, 500 Ohm, cu conector 4 pini

Pret : 39.65 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon dinamic conector 6 piniMicrofon dinamic conector 6 pini Pihernz - DMC-502-6T

Microfon dinamic conector 6 pini, Impedanta 500 Ohm

Pret : 29.26 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon pentru statii INTEK MC-S50Microfon statie Intek INTEK - MC-S50

Microfon pentru statii Intek, conector 6-pini, taste UP/DN/LOCK, pentru Intek M-550 Power

Pret : 36.82 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon pentru statii radio mobile INTEK DMC-507Microfon pentru statii radio mobile INTEK - DMC-507

Microfon dinamic statie CB, 500 Ohm, fara conector

Pret : 28.32 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon dinamic conector 6 piniMicrofon dinamic conector 6 pini Super Star - DMC-508-6T

Microfon dinamic conector 6 pini, Impedanta: 500 Ohm

Pret : La cerere
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon pentru statii radio mobile INTEK DMC-507-4PMicrofon pentru statii radio mobile INTEK - DMC-507-4P

Microfon dinamic statie CB, 500 Ohm, cu conector 4 pini

Pret : 33.04 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon dinamic conector 4 piniMicrofon dinamic conector 4 pini Pihernz - DMC-502-4T

Microfon dinamic conector 4 pini, Impedanta 500 Ohm

Pret : 24.54 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Spuport microfon fluorescentSpuport microfon fluorescent Performer - SMF-9

Spuport microfon fluorescent, autoadeziv

Pret : La cerere
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon dinamic conector 4 piniMicrofon dinamic conector 4 pini Super Star - DMC-508-4T

Microfon dinamic conector 4 pini, Impedanta: 500 Ohm

Pret : La cerere
*) Pretul nu contine TVA
Disponibilitate : Sunati
Suport pentru microfonSuport pentru microfon Performer - SMB-9

Suport din plastic pentru microfon, negru, autoadeziv

Pret : La cerere
*) Pretul nu contine TVA
Disponibilitate : Sunati
Suport metalic pentru microfonSuport metalic pentru microfon Performer - SM

Suport metalic pentru microfon

Pret : La cerere
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon pentru statii radio mobile KIRISUN CDM-453Microfon pentru statii radio mobile KIRISUN - CDM-453

Microfon statie (conector cu 4 pini)

Pret : 34.46 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon pentru statii radio mobile KIRISUN CDM-84CMicrofon pentru statii radio mobile KIRISUN - CDM-84C

Microfon statie (conector cu 4 pini)

Pret : 29.26 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati

Microfoane cu VOX si casti pentru statii portabile

Set casti cu microfon si control PTTSet casti cu microfon si control PTT INTEK - KME-801

Set casti cu microfon cu control PTT, prindere ureche

Pret vechi: 51.92 RON
Pret nou:
38.70 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon extern cu difuzor si PTT pentru statii portabile VHFMicrofon extern cu difuzor si PTT pentru statii portabile VHF Alinco - EMS-59

ALINCO microfon extern cu difuzor si PTT pentru statii portabile VHF

Pret : 70.80 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set casti cu microfon pentru statii radio Intek KME-200ASet casti cu microfon pentru statii radio INTEK - KME-200A

Set casti cu microfon si PTT cu prindere la ureche

Pret : 44.84 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set hands-free pentru motocicleteSet hands-free pentru motociclete INTEK - HS-2PIN-S/INT

INTEK, set casti cu microfon pentru motociclisti, casti integrale, jack tip S

Pret : 94.40 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set casti cu microfon pentru statii radio Intek KME-100ASet casti cu microfon pentru statii radio INTEK - KME-100A

Set casti cu microfon si PTT

Pret : 30.68 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set casti cu microfon pentru statii radioSet casti cu microfon pentru statii radio INTEK - KME-614

Set casti cu microfon si PTT cu prindere la ureche

Pret : 37.76 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set casti cu microfon INTEK ESM-555Set casti cu microfon INTEK - ESM-555

INTEK, set casti cu microfon, cablu 1,4m cu 2 mufe jack, pt M-60 si M-899 VOX

Pret : 38.70 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon PTT Alinco EME-12Microfon PTT Alinco - EME-12

ALINCO, microfon PTT cu VOX si microcasca

Pret : 158.59 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon/difuzor KIRISUN KME-H20AMicrofon/difuzor KIRISUN - KME-H20A

Microfon/Difuzor, receptor pentru PT-4200 & PT-558

Pret : 56.64 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon statie INTEK MT-SM100Microfon statie INTEK - MT-SM100

INTEK, casca cu microfon, cu tasta PTT, clip de cravata, jack de tip S

Pret : 36.82 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set casti cu microfon si PTT Intek MT-SM200-NSet casti cu microfon si PTT INTEK - MT-SM200-N

Set casti cu microfon si PTT

Pret : 51.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
INTEK ESM-10, set casti cu microfon pt SL-02Set casti cu microfon INTEK - ESM-10

INTEK, set casti cu microfon pt SL-02

Pret : 36.34 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set hands-free pentru motocicleteSet hands-free pentru motociclete INTEK - HS-2PIN-S/JET

 INTEK, set casti cu microfon pentru motociclisti, casti deschise, jack tip K

Pret : 94.40 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon Hands-Free, conector 4 piniMicrofon Hands-Free, conector 4 pini Pihernz - ML-27-4T

Microfon Hands-Free, conector 4 pini

Pret : 129.33 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon Hands-Free, conector 6 piniMicrofon Hands-Free, conector 6 pini Pihernz - ML-27-6T

Microfon Hands-Free, conector 6 pini

Pret : 137.82 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
microfon cu vox si casca Alinco EME-15microfon cu vox si casca Alinco - EME-15

ALINCO, microfon cu vox si casca

Pret : 143.48 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon/speaker KIRISUN KME-62AMicrofon/difuzor KIRISUN - KME-62A

Microfon/difuzor de mana, 9 pini, pentru PT-6200

Pret : 61.36 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon cu difuzor pentru statie portabila KIRISUN - SPM-900

Microfon cu difuzor pentru statie portabila (mufa iCOM)

Pret : 35.87 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon cu difuzor pentru statie portabila KIRISUN - SPM-901

Microfon cu difuzor pentru statie portabila (mufa Kenwood)

Pret : 35.87 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set hands-free pentru motocicleteSet hands-free pentru motociclete INTEK - HS-2PIN-K/INT

INTEK, set casti cu microfon pentru motociclisti, casti integrale, jack tip K

Pret : 94.40 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Set hands-free pentru motocicleteSet hands-free pentru motociclete INTEK - HS-2PIN-K/JET

INTEK, set casti cu microfon pentru motociclisti, casti deschise, jack tip K

Pret : 94.40 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon/difuzor KIRISUN - KME-62B

Microfon/casca ureche, 9 pini, pentru PT-6200

Pret : 42.48 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Husa piele pentru statii radio KIRISUN - KPT-05

Husa piele pentru PT-4200 & PT-558

Pret : 28.32 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon/difuzor KIRISUN - KME-315

Microfon/Difuzor, casca ureche pentru PT-4200 & PT-558

Pret : 29.74 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Microfon/difuzor KIRISUN - KME-004

Microfon/Difuzor, prindere ureche pentru PT-4200 & PT-558

Pret : 33.04 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Husa Piele pentru statii radio KIRISUN - KPT-07

Husa piele pentru PT-6200

Pret : 37.76 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
ESM-444Set casti cu microfon INTEK - ESM-444

INTEK, set casti cu microfon si agatare pe gat, cablu 1,4m cu 1 mufa jack pentru M60 Plus si M-899 VOX

Pret : 30.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept