Curs valutar

18-Jul-2019

1 EURO = 4.7345 RON  
1 USD = 4.2201 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic

ANPC

 » KIT-uri complete supraveghere video



NVRKIT1004

KIT 4 Camere IP HD-cloud technology 1.0Mpx

Braun Group - NVRKIT-1004

Sistem de supraveghere IP complet (4 Camere+NVR+accesorii), 1Mpx Cloud Technology 1/4" High-resolution CMOS Sensor, OV 9712+Hi3518C; Main Stream: 1MPx 1280*720, D1:640*480, CIF:320*240 ; 2MPx HD 4mm:72° viewing angle Lens, IR-CUT; carcasa aluminiu rezistenta la intemperii (IP66); Distanta IR: 30m

Alte imagini:
NVRKIT1004 soft smartphoneNVRKIT1004 ProprietatiNVRKIT1004 continut





Pret vechi fara TVA :
1.211,00 RON


Pret nou fara TVA :
476,90 RON

Pret nou cu TVA :
567,51 RON

Disponibilitate :
Sunati

Optional:

HDD-1TB - Seagate Surveillance SV-35(ST1000VX000) 3.5", SATA III 600, 64MB Cache

HDD-2TB - Seagate Surveillance SV-35(ST2000VX000) 3.5", SATA III 600, 64MB Cache

HDD-3TB - Seagate Surveillance SV-35(ST3000VX000) 3.5", SATA III 600, 64MB Cache

 

Features :

  •  With H.264 High efficiency Video Compression
  •  Support 1ch playback
  •  With unique time screen in front of the panel, and displays recorder.
  •  Support Iphone, Android.
  •  Support 1*HDD(3TB), With 2*USB2.0 for backup, burning, upgrading operation
  •  Stronger network service. support IE browse and CMS software
  •  Support Romanian, English, , German, Russian, Italian, Portuguese, Spanish, French ..... . 30 language
  •  Build-in 3322.org,dyndns.net,oray.net and  myq-see.com free DDNS dynamic domain name
  •  Built-in own free DDNS Domain Name Server: http:// www.nvsip.com
  •  With HDMI, Support 1080P the high-definition (1920 * 1080P)
  •  With ONVIF protocol, can connect the ONVIF IP camera directly, also can by IE and CMS.
  •  Support P2P cloud functions
  •  1.0 Megapixel Waterproof IR Cameras * 4units.
  •  20M POE Network cable * 4rolls; 1.5M Network cable * 1roll
  •  Power Adapter * 2units(one for NVR; one for cameras)

 

 

Technical Specifications:

 

NVR Specifications

 

Model

NVR-1004

System

Main processor

Hi3515A chip

Screen display

1/4

Video

Video standar

PAL(625TVL,50 Fields / sec. ;NTSC(525TVL,60 Fields / sec. )

Video quality

Monitor :D1;VGA: HD;HDMI:HD

Coding capacity

1080P/720P/960H/D1/HD1/CIF/QCIF

Digital input

4*960P

Motion Detection

Each screen can be set to 192 (16 × 12) detection area; multi-level sensitivity can be set

Video playback

Video mode

Manual> Alarm> Motion detection> timing

Local Playback

Single

Video inquiry

Point-in-time retrieval, calendar search, event search, channel search

Storage backup

Space

CIF: 5G / day / channel   D1: 20G / day / channel   720P: 40G / day /channel   1080P: 80 G/ day/channel

Video save

HDD.  Network

Backup mode

Network  backup、USB mobile HDD、USB Burner,DVD CD burning

Interface

Video input

No

Video output

1ch BNC output,1ch SPOT output,1ch VGA output,1ch HDMI output(1920*1080P)

Audio input

1ch RCA

Audio output

1ch RCA audio output

Alarm input

NO

Alarm output

NO

Network interface

RJ45 10M/100M/1000M

PTZ control

One  RS485 ptz control interface

USB interface

2*USB interface

HDD

1 SATA (3TB)

Others

Power supply

12V/2A

Size

390(width)x30(deepth)x100(hight)mm

weight

2.2kg(not including HDD)

IP Camera Specification

Model

IPC-A100

Image sensor

1/4-inch 1.0 Megapixel Cmos OV 9712+Hi3518C

Video Resolution

1MP:1280*720  D1:640*480  CIF:320*240

Effective Pixels

1.0 Mega  720P

Video Compression

H.264

Video frame rate

25FPS

Video bit rate

128Kbps~8Mbps

Synchronization

Internal Synchronization

SNR

39dB

Minimum illumination

0Lux(IR ON)

Interface Type

MTV

Lens

Default 2.0 Megapixel 4mm Lens

Lens Viewing Angle

Focus System

4mm:72°,6mm:48.8°,8mm:37°, 12mm:24.2°

Fixed

Privacy

Supports four block area block

Exposure Control

Automatic

Gain Control

Automatic

Dynamic Range

69dB

White Balance

Automatic

Day and night function

IR-CUT Inside

Video Tuning

contrast,brightness,saturation, sharpness adjustment

Remote operation

System settings,stream management,account management,network management

Motion Detection

supported

Detection and alarm

E-mail alerts, alarm client

Ethernet

10/100M Ethernet, RJ45 port

Stream

Support three stream

Network protocol

Standard HTTP, TCP/IP, ICMP. RTSP, RTP, UDP, RTCP, SMTP, FTP, DHCP, DNS, PPPOE

Network transmission

P2P penetrate automatic forwarding

Temperature

-20C~+55℃

Humidity

10%~90%

Led

48pcs 12Mil ф5 IR Leds, IR distance 30M

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept