Curs valutar


1 EURO = 4.7524 RON  
1 USD = 4.3164 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » KIT-uri complete supraveghere video


KIT 4 Camere IP HD-cloud technology 1.0Mpx

Braun Group - NVRKIT-1004

Sistem de supraveghere IP complet (4 Camere+NVR+accesorii), 1Mpx Cloud Technology 1/4" High-resolution CMOS Sensor, OV 9712+Hi3518C; Main Stream: 1MPx 1280*720, D1:640*480, CIF:320*240 ; 2MPx HD 4mm:72° viewing angle Lens, IR-CUT; carcasa aluminiu rezistenta la intemperii (IP66); Distanta IR: 30m

Alte imagini:
NVRKIT1004 soft smartphoneNVRKIT1004 ProprietatiNVRKIT1004 continut

Pret vechi fara TVA :
1.211,00 RON

Pret nou fara TVA :
476,90 RON

Pret nou cu TVA :
567,51 RON

Disponibilitate :


HDD-1TB - Seagate Surveillance SV-35(ST1000VX000) 3.5", SATA III 600, 64MB Cache

HDD-2TB - Seagate Surveillance SV-35(ST2000VX000) 3.5", SATA III 600, 64MB Cache

HDD-3TB - Seagate Surveillance SV-35(ST3000VX000) 3.5", SATA III 600, 64MB Cache


Features :

  •  With H.264 High efficiency Video Compression
  •  Support 1ch playback
  •  With unique time screen in front of the panel, and displays recorder.
  •  Support Iphone, Android.
  •  Support 1*HDD(3TB), With 2*USB2.0 for backup, burning, upgrading operation
  •  Stronger network service. support IE browse and CMS software
  •  Support Romanian, English, , German, Russian, Italian, Portuguese, Spanish, French ..... . 30 language
  •  Build-in,, and free DDNS dynamic domain name
  •  Built-in own free DDNS Domain Name Server: http://
  •  With HDMI, Support 1080P the high-definition (1920 * 1080P)
  •  With ONVIF protocol, can connect the ONVIF IP camera directly, also can by IE and CMS.
  •  Support P2P cloud functions
  •  1.0 Megapixel Waterproof IR Cameras * 4units.
  •  20M POE Network cable * 4rolls; 1.5M Network cable * 1roll
  •  Power Adapter * 2units(one for NVR; one for cameras)



Technical Specifications:


NVR Specifications





Main processor

Hi3515A chip

Screen display



Video standar

PAL(625TVL,50 Fields / sec. ;NTSC(525TVL,60 Fields / sec. )

Video quality

Monitor :D1;VGA: HD;HDMI:HD

Coding capacity


Digital input


Motion Detection

Each screen can be set to 192 (16 × 12) detection area; multi-level sensitivity can be set

Video playback

Video mode

Manual> Alarm> Motion detection> timing

Local Playback


Video inquiry

Point-in-time retrieval, calendar search, event search, channel search

Storage backup


CIF: 5G / day / channel   D1: 20G / day / channel   720P: 40G / day /channel   1080P: 80 G/ day/channel

Video save

HDD.  Network

Backup mode

Network  backup、USB mobile HDD、USB Burner,DVD CD burning


Video input


Video output

1ch BNC output,1ch SPOT output,1ch VGA output,1ch HDMI output(1920*1080P)

Audio input

1ch RCA

Audio output

1ch RCA audio output

Alarm input


Alarm output


Network interface

RJ45 10M/100M/1000M

PTZ control

One  RS485 ptz control interface

USB interface

2*USB interface


1 SATA (3TB)


Power supply





2.2kg(not including HDD)

IP Camera Specification



Image sensor

1/4-inch 1.0 Megapixel Cmos OV 9712+Hi3518C

Video Resolution

1MP:1280*720  D1:640*480  CIF:320*240

Effective Pixels

1.0 Mega  720P

Video Compression


Video frame rate


Video bit rate



Internal Synchronization



Minimum illumination

0Lux(IR ON)

Interface Type



Default 2.0 Megapixel 4mm Lens

Lens Viewing Angle

Focus System

4mm:72°,6mm:48.8°,8mm:37°, 12mm:24.2°



Supports four block area block

Exposure Control


Gain Control


Dynamic Range


White Balance


Day and night function

IR-CUT Inside

Video Tuning

contrast,brightness,saturation, sharpness adjustment

Remote operation

System settings,stream management,account management,network management

Motion Detection


Detection and alarm

E-mail alerts, alarm client


10/100M Ethernet, RJ45 port


Support three stream

Network protocol


Network transmission

P2P penetrate automatic forwarding






48pcs 12Mil ф5 IR Leds, IR distance 30M


Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept